DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and AgaP_AGAP005709

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:XP_556350.3 Gene:AgaP_AGAP005709 / 3290027 VectorBaseID:AGAP005709 Length:268 Species:Anopheles gambiae


Alignment Length:265 Identity:75/265 - (28%)
Similarity:119/265 - (44%) Gaps:28/265 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LLGLSGLVSITAIRIKGNSTDGRFYKDQRIIGGQAAEDGFAPYQISLQGISGAHS---CGGAIIN 70
            ||.|...|:..|:.| |..::.|.  :.||.||:..:....|:.:.:. |||:.|   |.|.:|:
Mosquito     4 LLVLCAFVAGGAMAI-GTVSETRL--NARISGGELTDPRAVPFIVGIL-ISGSSSHSFCAGILIS 64

  Fly    71 ETFVLTAAHCVENAFIPWLVVVTGTNKYNQPGGRYFLKAIHIHCNYDNPEMHNDIALLELVEPIA 135
            ...|||.|.||.|.  |.|.|:.|.:...:......:..|.||.||.:....:|:|:|.:.....
Mosquito    65 PRHVLTTASCVSNR--PTLTVLLGASDMTRIQQFIGVANILIHPNYSSLFNRDDLAILTMDRDTP 127

  Fly   136 WDERTQPIPLP----LVPMQPGDEVILTGWGSTVLWGTSPI---DLQVLYLQYVPHRECKALLSN 193
            .:|..|...||    :.....|....::|||:|......||   :||.:....:.:..|.  :|:
Mosquito   128 LNEYIQVANLPRWSHMGNTFNGFGTTISGWGNTGNRDNEPIPTPNLQSIRTPVISNTVCG--ISH 190

  Fly   194 DEDCDVGHICTFSRLGEGACHGDSGGPL----VSNGYLVGLVNWGWP----CATGVPDVHASVYF 250
            :...| .||||...:| |.|:||.|||:    .....::|:.::.:.    |..|...||..:..
Mosquito   191 NFIRD-DHICTSGDIG-GPCNGDDGGPVTITEAGQPIVIGMHSFHYSGLFGCDRGRSAVHVRLSS 253

  Fly   251 YRDWI 255
            |..||
Mosquito   254 YLSWI 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 65/235 (28%)
Tryp_SPc 38..258 CDD:238113 66/236 (28%)
AgaP_AGAP005709XP_556350.3 Tryp_SPc 29..258 CDD:214473 65/235 (28%)
Tryp_SPc 30..261 CDD:238113 66/236 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.