DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and AgaP_AGAP005663

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:XP_556312.2 Gene:AgaP_AGAP005663 / 3290018 VectorBaseID:AGAP005663 Length:317 Species:Anopheles gambiae


Alignment Length:249 Identity:81/249 - (32%)
Similarity:120/249 - (48%) Gaps:43/249 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 RIIGGQAAEDGFAPYQISLQG--ISGAHSCGGAIINETFVLTAAHCVENAFIPWLVVVTGT---- 95
            ||..||.|..|..||||:|..  .:|...|||:::...::|||||||.:.  ...:..:||    
Mosquito    72 RITNGQEATPGQFPYQIALLSNFATGTGLCGGSVLTNNYILTAAHCVISG--ATTLATSGTAIMG 134

  Fly    96 ---NKYNQPGGR---YFLKAIHIHCNYDNPEMHNDIALLELVEPIAWDERTQPIPLP--LVPMQP 152
               ...|:|..:   :....|..|..|:...:.||||::.|..||.:..|.|||.||  ....|.
Mosquito   135 AHNRNVNEPTQQRIGFTSAGIRAHPGYNPTNIRNDIAVVRLNSPITFTARIQPIRLPGRSDSRQF 199

  Fly   153 GDEV-ILTGWGSTVLWG-TSPIDLQVLYLQYVPHRECKALLSNDEDC---------DVGHICTFS 206
            |... .::|:|.|...| |||:   |::..       ..:::| .||         ...::|...
Mosquito   200 GGFTGTVSGFGRTTNTGATSPV---VMFTS-------NPVMTN-ADCIARWNTALIQPQNVCLSG 253

  Fly   207 RLGEGACHGDSGGPL-VSNG--YLVGLVNWGWP--CATGVPDVHASVYFYRDWI 255
            ..|..:|:||||||| |.:|  ..:|:|::|..  |:.|:|.|:|.|.||.|||
Mosquito   254 DGGRSSCNGDSGGPLTVQDGGSLQIGIVSFGSAAGCSIGMPSVYARVSFYLDWI 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 79/247 (32%)
Tryp_SPc 38..258 CDD:238113 80/248 (32%)
AgaP_AGAP005663XP_556312.2 Tryp_SPc 72..307 CDD:214473 79/247 (32%)
Tryp_SPc 73..310 CDD:238113 80/248 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.