DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and AgaP_AGAP005665

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:XP_556314.2 Gene:AgaP_AGAP005665 / 3290017 VectorBaseID:AGAP005665 Length:300 Species:Anopheles gambiae


Alignment Length:256 Identity:76/256 - (29%)
Similarity:117/256 - (45%) Gaps:56/256 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 RIIGGQAAEDGFAPYQISLQG--ISGAHSCGGAIINETFVLTAAHCV----ENAFIPWLVVVTGT 95
            ||:.||.|..|..||||:|..  .:|...|||:::...::|||||||    ....:....::...
Mosquito    54 RIVNGQEATPGQFPYQIALLSNFPTGTGLCGGSVLTNNYILTAAHCVISGASTLALGGTAIIGAH 118

  Fly    96 NK-YNQPGGR---YFLKAIHIHCNYDNPEMHNDIALLELVEPIAWDERTQPIPLPL---VPMQPG 153
            |: ..:|..:   :....|..|..|....:.||||::.|..||.:.:|.||..||.   .....|
Mosquito   119 NRDVAEPSQQRIAFSTAGIRAHPGYTLTNIRNDIAVVRLNSPITFTDRIQPARLPARSDTRQFGG 183

  Fly   154 DEVILTGWG----------STVLWGTSPIDLQVLYLQYVPHRECKALLSNDEDC---------DV 199
            ....::|:|          |.|::.|:|:                  |:| .||         :.
Mosquito   184 FTGTVSGFGRTSDASQATSSVVMFTTNPV------------------LTN-ADCIAQWNAVVIEP 229

  Fly   200 GHICTFSRLGEGACHGDSGGPL-VSNG--YLVGLVNWGWP--CATGVPDVHASVYFYRDWI 255
            .::|.....|..:|:||||||| |.:|  ..||:|::|..  ||.|:|.|:|.|.|:.|:|
Mosquito   230 QNVCLSGAGGRSSCNGDSGGPLAVQDGGSLQVGVVSFGSAAGCAIGMPSVYARVSFFLDFI 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 75/254 (30%)
Tryp_SPc 38..258 CDD:238113 75/255 (29%)
AgaP_AGAP005665XP_556314.2 Tryp_SPc 54..290 CDD:214473 75/254 (30%)
Tryp_SPc 55..293 CDD:238113 75/255 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.