DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and AgaP_AGAP005642

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:XP_556287.3 Gene:AgaP_AGAP005642 / 3290013 VectorBaseID:AGAP005642 Length:313 Species:Anopheles gambiae


Alignment Length:244 Identity:74/244 - (30%)
Similarity:115/244 - (47%) Gaps:35/244 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 RIIGGQAAEDGFAPYQISLQG--ISGAHSCGGAIINETFVLTAAHCVENAFIPWLVVVTGTNKYN 99
            ||:||..|..|..|||:::..  .:|...|||.:::..|||||..||||. ...:||:...|..|
Mosquito    69 RIVGGSIATAGQIPYQVAILSDLEAGQALCGGVLLSNNFVLTAGVCVENT-SGGVVVLGALNLQN 132

  Fly   100 Q-PGGR----YFLKAIHIHCNYDNPEMHNDIALLELVEPIAWDERTQPIPLPLVP---MQPGDEV 156
            : ..|:    :....:.:|..:......|:||.:.|.||:::.:|.||:.:|...   ...|...
Mosquito   133 EAEAGQVRITFAAGDVRLHEEFLAVIFRNNIAAIRLSEPVSFSDRIQPVRIPAAADGRTFAGALA 197

  Fly   157 ILTGWGSTVLWGTSPIDLQVLYLQYVPHRECKALLSNDEDC---------DVGHICTFSRLGEGA 212
            .::|:|.|....||..|:    |:||.:    .:::| .||         |...:|.........
Mosquito   198 TVSGFGRTSDSSTSFSDV----LRYVRN----PIMTN-ADCFATAWGGLIDGQKMCLHYMEARAP 253

  Fly   213 CHGDSGGPL-VSNG---YLVGLVNWG--WPCATGVPDVHASVYFYRDWI 255
            |.||.|||: |::|   .||||.::|  ..|.:..|.|...:.|||.||
Mosquito   254 CDGDVGGPMTVADGGSTLLVGLYSFGSVLGCESDWPAVFVRITFYRQWI 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 72/242 (30%)
Tryp_SPc 38..258 CDD:238113 73/243 (30%)
AgaP_AGAP005642XP_556287.3 Tryp_SPc 69..302 CDD:214473 72/242 (30%)
Tryp_SPc 70..302 CDD:238113 71/241 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.