DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and Prss34

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_848459.1 Gene:Prss34 / 328780 MGIID:2681414 Length:318 Species:Mus musculus


Alignment Length:268 Identity:70/268 - (26%)
Similarity:109/268 - (40%) Gaps:73/268 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 IIGGQAAEDGFAPYQISLQGISGAHS-----CGGAIINETFVLTAAHCV---------------- 81
            |:||........|:|:||:.....||     |||::|:..:||||||||                
Mouse    35 IVGGCPVSASRFPWQVSLRLYDMEHSRWEHECGGSLIHPQWVLTAAHCVRPKEVEAYGVRVQVGQ 99

  Fly    82 ----ENAFIPWLVVVTGTNKYNQP----GGRYFLKAIHIHCNYDNPEMHNDIALLELVEPIAWDE 138
                ||..:..:|.:....|:::.    ||.                   |||||:|...:...|
Mouse   100 LRLYENDQLMKVVKIIRHPKFSEKLSARGGA-------------------DIALLKLDTRVVLSE 145

  Fly   139 RTQPIPLPLVPMQPGDEVI--LTGWGSTVLWGTSPI----DLQVLYLQYVPHRECKALLSNDEDC 197
            ...|:.||...::...:..  :.|||  |:....|:    .|:.:.:..|.:.:|:.....:...
Mouse   146 HVYPVSLPAASLRISSKKTCWVAGWG--VIENYMPLPPPYHLREVAVPIVENNDCEQKYQTNSSS 208

  Fly   198 DV-------GHICTFSRLGEGACHGDSGGPLV----SNGYLVGLVNWGWPCATGVPD---VHASV 248
            |.       ..:|. .:.|..:|..|||||||    .:...||:|:||..|  |:||   |:..|
Mouse   209 DSTTRIIKDDMLCA-GKEGRDSCKADSGGPLVCRWNCSWVQVGVVSWGIGC--GLPDFPGVYTRV 270

  Fly   249 YFYRDWIR 256
            ..|..||:
Mouse   271 MSYVSWIK 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 68/265 (26%)
Tryp_SPc 38..258 CDD:238113 70/268 (26%)
Prss34NP_848459.1 Tryp_SPc 35..278 CDD:238113 69/266 (26%)
Tryp_SPc 35..277 CDD:214473 68/265 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.