DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and CG4653

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_573150.2 Gene:CG4653 / 32650 FlyBaseID:FBgn0030776 Length:254 Species:Drosophila melanogaster


Alignment Length:279 Identity:83/279 - (29%)
Similarity:123/279 - (44%) Gaps:64/279 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SAVVLLILLGLSGLVSITAIRIKGNSTDGRFYKDQRIIGGQAAEDGFAPYQISLQGISGAHSCGG 66
            |.::||:::...|:|..:.:                     .||.|..|:.|||:. :|.|.|||
  Fly    10 SRLLLLVVIVTLGVVQSSRL---------------------PAEVGSQPHSISLRR-NGVHVCGG 52

  Fly    67 AIINETFVLTAAHCVENAFIPWLVVVTGTNKYNQP---------------GGRYF-LKAIHIHCN 115
            |:|.|.::|||||||.          .|..:.:.|               ||:.. |..|.||.|
  Fly    53 ALIREKWILTAAHCVS----------LGGGQQSYPAKSYNVRVGSIQRLTGGQLVPLSKIIIHTN 107

  Fly   116 YDNPEM--HNDIALLELVEPIAWDERTQPIPLPLVPMQPGDEVILTGWGSTVLWGTSPIDLQVLY 178
            |.:.:.  .||:|||||...:..:..|.||.|.......|.::|.:||||:.:.|:....|||..
  Fly   108 YSSSDAVGSNDLALLELETSVVLNANTNPIDLATERPAAGSQIIFSGWGSSQVDGSLSHVLQVAT 172

  Fly   179 LQYVPHRECKA-LLSNDEDCDVGHICTFSRLGE---GACHGDSGGPLVSNGYLVGLVNW---GWP 236
            .|.:...:|:. |....||.    :| .|.:.|   |.|.||:|.|...|..|||:..:   |  
  Fly   173 RQSLSASDCQTELYLQQEDL----LC-LSPVDEDFAGLCSGDAGAPASYNNQLVGIAAFFVSG-- 230

  Fly   237 CATGVPDVHASVYFYRDWI 255
            |.:..||.:..|..:.:||
  Fly   231 CGSEQPDGYVDVTQHLEWI 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 76/242 (31%)
Tryp_SPc 38..258 CDD:238113 78/243 (32%)
CG4653NP_573150.2 Tryp_SPc 30..252 CDD:238113 78/238 (33%)
Tryp_SPc 30..249 CDD:214473 76/236 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.