DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and CG9676

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_728008.1 Gene:CG9676 / 32647 FlyBaseID:FBgn0030773 Length:251 Species:Drosophila melanogaster


Alignment Length:237 Identity:81/237 - (34%)
Similarity:120/237 - (50%) Gaps:32/237 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 DQRIIGGQAAEDGFAPYQISLQGISGAHSCGGAIINETFVLTAAHCVE--NAFIP--WLVVVTGT 95
            :.||:||..|.:|..|:||||:. .|:|:|||:||::.:|:||||||:  |...|  .|.:..|:
  Fly    25 EPRIVGGTKAREGQFPHQISLRR-RGSHTCGGSIISKDYVVTAAHCVKQGNNVAPANELEIQAGS 88

  Fly    96 NKYNQPGGRYFLKAIHIHCNYDNPEMHNDIALLELVEPIAWDERTQPIPLPLVPMQPGDEVI-LT 159
            ...:..|.|..:..:.:|.|| |...| |:|:|.|...:.::.....|.| .....|.|..: ::
  Fly    89 LLLSSGGVRVPVATVTVHPNY-NSNGH-DVAVLRLRNSLTFNSNIAAIKL-ATEDPPNDATVDIS 150

  Fly   160 GWGSTVLWGTSPIDLQVLYLQYVPHRECKALLSNDEDCDVGHI--------CTFSRLGEGACHGD 216
            |||:....|  ||...:||:|      .|||  :.|.|...::        |......:|||:||
  Fly   151 GWGAISQRG--PISNSLLYVQ------VKAL--SRESCQKTYLRQLPETTMCLLHPKDKGACYGD 205

  Fly   217 SGGPLVSNGYLVGLVNW---GWPCATGVPDVHASVYFYRDWI 255
            ||||....|.||||.::   |  |....||.:..|...|:||
  Fly   206 SGGPATYQGKLVGLASFVIGG--CGRAAPDGYERVSKLRNWI 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 79/233 (34%)
Tryp_SPc 38..258 CDD:238113 80/234 (34%)
CG9676NP_728008.1 Tryp_SPc 27..245 CDD:214473 79/233 (34%)
Tryp_SPc 28..248 CDD:238113 80/234 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.