DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and CG33160

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_788456.1 Gene:CG33160 / 326265 FlyBaseID:FBgn0053160 Length:258 Species:Drosophila melanogaster


Alignment Length:272 Identity:72/272 - (26%)
Similarity:121/272 - (44%) Gaps:42/272 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LVSITAIRIKGNSTDGRFYKDQ-----RIIGGQAAEDGFAPYQISLQGISGAHSCGGAIINETFV 74
            |.|:..::|.|..:....:.|.     |||||..:......|.:  |..:....|||:::...:|
  Fly     6 LTSLFLVQILGFHSAVYAHPDSVQIQPRIIGGHVSSIKEEKYLV--QVTTSEELCGGSLVKPRWV 68

  Fly    75 LTAAHCVENAFIPWLVVVTGTNKYNQPGGRYFLKA---IHIHCNYDNPEMHNDIALLEL-VEPIA 135
            :||||||.|.......:..|.:  ||.|....::.   |.|..:::...::.|:|.|.| .:.|.
  Fly    69 ITAAHCVYNKNKNDFKIYGGAS--NQAGPYAVIRTVDYIAIRPDFNRKTLNMDVAALRLNSDMIG 131

  Fly   136 WDERTQPIPLPLVPMQPGDEVILTGWGSTVLWGTSPIDLQVLYLQYVP--------------HRE 186
            .:..|.|:....||.:.  .|.::|||......|...:.  ::...||              ||.
  Fly   132 ANIETIPLAAQSVPARA--LVKVSGWGFLTADATKTAER--VHSVLVPMWSRASCVSAFRGIHRI 192

  Fly   187 CKALLSNDEDCDVGHICTFSRLGEGACHGDSGGPLVSNGYLVGLVNWGWPCATGVPDVHASVYFY 251
            .:::           :|......:.:|.||||||||..|.|.|:|::|:.||:.:|.::.||...
  Fly   193 TRSM-----------VCAARLYKKDSCDGDSGGPLVYRGQLAGIVSFGYGCASALPGIYTSVPEI 246

  Fly   252 RDWIRNVMSGNS 263
            |||.:.|:..:|
  Fly   247 RDWFQRVVEQHS 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 64/235 (27%)
Tryp_SPc 38..258 CDD:238113 64/237 (27%)
CG33160NP_788456.1 Tryp_SPc 33..249 CDD:214473 63/234 (27%)
Tryp_SPc 34..253 CDD:238113 64/237 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.