DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and CG31220

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_732440.2 Gene:CG31220 / 326126 FlyBaseID:FBgn0051220 Length:363 Species:Drosophila melanogaster


Alignment Length:309 Identity:83/309 - (26%)
Similarity:119/309 - (38%) Gaps:69/309 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 SGLVSITAIRIKGNST-DGRFYK------------------------DQRIIGGQAAEDGFAPYQ 52
            |..|:|:..|:.|.|. |.:.||                        ..|:|||........|:.
  Fly    54 SAKVNISQTRMCGVSVRDRKRYKRIYICCPKPANTLPSYPDCGKPQTTNRVIGGTEPNLNEYPWL 118

  Fly    53 ISL--QGISGAH-------SCGGAIINETFVLTAAHCVENAFIPWLVVVTG--TNKYN----QPG 102
            ..|  :..|..:       ||||::||..:||||||||.:..:....|..|  |..:|    ..|
  Fly   119 AMLLYRNRSAFNPDRELVPSCGGSLINTRYVLTAAHCVTDTVLQIQRVRLGEHTTSHNPDCISRG 183

  Fly   103 GRYFLKAIHI---------HCNYD--NPEMHNDIALLELVEPIAWDERTQPI-----PLPLVPMQ 151
            .|......|:         |.:||  |....|||||:.|.||:.:.....||     |..|:.. 
  Fly   184 ARIVCAPTHLDIDVESITSHNDYDPANYTFRNDIALVRLKEPVRYTMAYYPICVLDYPRSLMKF- 247

  Fly   152 PGDEVILTGWGSTVLWGTSPIDLQVLYLQYVPHRECKALLSNDEDCDVGHICTFSRLGEGACHGD 216
               ::.:.|||.|.::.|....|:...::.....||....::........||.......|.|.||
  Fly   248 ---KMYVAGWGKTGMFDTGSKVLKHAAVKVRKPEECSEKYAHRHFGPRFQICAGGLDNRGTCDGD 309

  Fly   217 SGGPLVSNG--------YLVGLVNWGWPCAT-GVPDVHASVYFYRDWIR 256
            ||.||:...        :|.|:.::|.||.| |.|.|......:..|||
  Fly   310 SGSPLMGTSGRSYETITFLAGITSYGGPCGTIGWPSVFTRTAKFYKWIR 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 71/257 (28%)
Tryp_SPc 38..258 CDD:238113 73/259 (28%)
CG31220NP_732440.2 Tryp_SPc 103..357 CDD:214473 71/257 (28%)
Tryp_SPc 104..360 CDD:238113 73/259 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.