DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and f2

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:XP_005169022.1 Gene:f2 / 325881 ZFINID:ZDB-GENE-030131-4606 Length:635 Species:Danio rerio


Alignment Length:273 Identity:80/273 - (29%)
Similarity:134/273 - (49%) Gaps:47/273 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 YKDQRIIGGQAAEDGFAPYQISLQGISGAH-SCGGAIINETFVLTAAHCVENAFIPW-------- 88
            |...||:||..||...||:|:.|...|... .||.::|::.::||||||:  .:.||        
Zfish   369 YTGSRIVGGDEAEVASAPWQVMLYKRSPQELLCGASLISDEWILTAAHCI--LYPPWNKNFTIND 431

  Fly    89 LVVVTGTN---KYNQPGGRYFLKAIH---IHCNYDNPE-MHNDIALLELVEPIAWDERTQPIPLP 146
            ::|..|.:   ||.:  |...:.||.   :|..|:..| ::.|||||.:.:|:.:.....|:.||
Zfish   432 IIVRLGKHSRTKYER--GIEKIVAIDEIIVHPKYNWKENLNRDIALLHMKKPVVFTSEIHPVCLP 494

  Fly   147 LVP-----MQPGDEVILTGWGS-TVLWGTSPID----LQVLYLQYVPHRECK----ALLSNDEDC 197
            ...     |..|.:..:||||: ...|.::|.:    ||.::|..|....|:    .:::::..|
Zfish   495 TKSIAKNLMFAGYKGRVTGWGNLRESWTSNPTNLPTVLQQIHLPIVDQSICRNSTSVIITDNMFC 559

  Fly   198 DVGHICTFSRLGEGACHGDSGGPLV------SNGYLVGLVNWGWPC-ATGVPDVHASVYFYRDWI 255
             .|:....|:.|: ||.||||||.|      :..|.:|:|:||..| ..|....:..::..|.|:
Zfish   560 -AGYQPDDSKRGD-ACEGDSGGPFVMKSPSDNRWYQIGIVSWGEGCDRDGKYGFYTHLFRMRRWM 622

  Fly   256 RNVM----SGNSK 264
            :.|:    ||:.:
Zfish   623 KKVIEKTDSGDDE 635

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 75/254 (30%)
Tryp_SPc 38..258 CDD:238113 75/256 (29%)
f2XP_005169022.1 GLA 39..100 CDD:214503
KR 126..206 CDD:214527
KR 228..309 CDD:214527
Thrombin_light 326..373 CDD:286482 1/3 (33%)
Tryp_SPc 373..621 CDD:214473 75/253 (30%)
Tryp_SPc 374..625 CDD:238113 75/256 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.