DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and CG8952

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_573072.1 Gene:CG8952 / 32525 FlyBaseID:FBgn0030688 Length:276 Species:Drosophila melanogaster


Alignment Length:233 Identity:69/233 - (29%)
Similarity:107/233 - (45%) Gaps:41/233 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LVSITAIRIKG------NSTDGRFYKDQRIIGGQAAEDGFAPYQISLQGISGAH-SCGGAIINET 72
            ||.:.||.:.|      ||:..:.  |.||:.|..|:.|..|:|:.|:..:... .|||:||::|
  Fly    11 LVLLAAISVVGQPFDPANSSPIKI--DNRIVSGSDAKLGQFPWQVILKRDAWDDLLCGGSIISDT 73

  Fly    73 FVLTAAHCVENAFIPWLVVVT----GTNKYNQPGGRYFLKAIHIHCNYDNPEMHNDIALLELVEP 133
            :|||||||.......:|:..|    ..|..|.....     |.||.:| |.:::||::|::|.||
  Fly    74 WVLTAAHCTNGLSSIFLMFGTVDLFNANALNMTSNN-----IIIHPDY-NDKLNNDVSLIQLPEP 132

  Fly   134 IAWDERTQPIPLPLVPMQPGDEVILTGWGSTVL-WGTSPIDLQVLYLQY-----------VPHRE 186
            :.:....|.|.|   ..|.||.:...|..:|:. :|.:..:    ||.|           :.:.:
  Fly   133 LTFSANIQAIQL---VGQYGDSIDYVGSVATIAGFGYTEDE----YLDYSETLLYAQVEIIDNAD 190

  Fly   187 CKALLSNDEDCDVGHICT--FSRLGEGACHGDSGGPLV 222
            |.|:.......| ..:|.  |.......|.|||||||:
  Fly   191 CVAIYGKYVVVD-STMCAKGFDGSDMSTCTGDSGGPLI 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 61/205 (30%)
Tryp_SPc 38..258 CDD:238113 60/204 (29%)
CG8952NP_573072.1 Tryp_SPc 37..268 CDD:214473 61/205 (30%)
Tryp_SPc 38..271 CDD:238113 60/204 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.