DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and prss59.1

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_955899.2 Gene:prss59.1 / 322453 ZFINID:ZDB-GENE-030131-1173 Length:242 Species:Danio rerio


Alignment Length:272 Identity:79/272 - (29%)
Similarity:135/272 - (49%) Gaps:40/272 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSAVVLLILLGLSGLVSITAIRIKGNSTDGRFYKDQRIIGGQAAEDGFAPYQISLQGISGAHSCG 65
            |.::|.|:|||.:..:.                 |.:|:||...:....|:|.||.  ||.|.||
Zfish     1 MRSLVFLVLLGAAFALD-----------------DDKIVGGYECQPNSQPWQASLN--SGYHFCG 46

  Fly    66 GAIINETFVLTAAHCVENAFIPWLVVVTGTNKYN---QPGGRYFLKAIHI--HCNYDNPEMHNDI 125
            |::::|.:|::||||.::.      |.....::|   ..|...|:.:..:  :.|||:.::.:||
Zfish    47 GSLVSEYWVVSAAHCYKSR------VEVRLGEHNIVINEGTEQFITSEKVIRNPNYDSWDLDSDI 105

  Fly   126 ALLELVEPIAWDERTQPIPLPLVPMQPGDEVILTGWGSTVLWGTSPIDLQVLYLQYVPHRECK-- 188
            .|::|.:|...::..||:.||......|....::|||:|:........||.|.:..:..|:|.  
Zfish   106 MLIKLSKPATLNKYVQPVALPNGCAADGTMCRVSGWGNTMSSTADSNKLQCLEIPILSDRDCNNS 170

  Fly   189 --ALLSNDEDCDVGHICTFSRLGEGACHGDSGGPLVSNGYLVGLVNWGWPCA-TGVPDVHASVYF 250
              .::::...| .|::    ..|:.:|.||||||:|.||.|.|:|:||:.|| ...|.|:..|..
Zfish   171 YPGMITDTMFC-AGYL----EGGKDSCQGDSGGPVVCNGELHGIVSWGYGCAEKNHPGVYGKVCM 230

  Fly   251 YRDWIRNVMSGN 262
            :..||.:.|..|
Zfish   231 FSQWIADTMRNN 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 68/227 (30%)
Tryp_SPc 38..258 CDD:238113 70/229 (31%)
prss59.1NP_955899.2 Tryp_SPc 20..235 CDD:214473 68/227 (30%)
Tryp_SPc 21..238 CDD:238113 70/229 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.