DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and CG31267

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_732214.1 Gene:CG31267 / 318651 FlyBaseID:FBgn0051267 Length:275 Species:Drosophila melanogaster


Alignment Length:267 Identity:105/267 - (39%)
Similarity:155/267 - (58%) Gaps:12/267 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 AVVLLILLGLSGLVSITAIRIKG-----NSTDGRFYKDQRIIGGQAAEDGFAPYQISLQGISGAH 62
            :.::|:||.||  .|..::|.:.     :.|..:|  ..||:||:.::...|||.:|||...|.|
  Fly     9 STLVLVLLALS--FSEASLRRRAFTSEKSETANKF--SSRIVGGEESDVLAAPYLVSLQNAYGNH 69

  Fly    63 SCGGAIINETFVLTAAHCVENAFIPWLVVVTGT-NKYNQPGGRYFLKAIHIHCNYDNPEMHNDIA 126
            .|.|:||::.:|:|||.|:.......:.|||.| |.:...|..|.::.|.:|||:|:|..|||||
  Fly    70 FCAGSIIHDQWVITAASCLAGLRKNNVQVVTTTYNHWGSEGWIYSVEDIVMHCNFDSPMYHNDIA 134

  Fly   127 LLELVEPIAWDERTQPIPL-PLVPMQPGDEVILTGWGSTVLWGTSPIDLQVLYLQYVPHRECKAL 190
            |::......:|:.||.|.: ||..:..|:.:.:.|:|||.:.|.....||.|.:.||...:|.|.
  Fly   135 LIKTHALFDYDDVTQNITIAPLEDLTDGETLTMYGYGSTEIGGDFSWQLQQLDVTYVAPEKCNAT 199

  Fly   191 LSNDEDCDVGHICTFSRLGEGACHGDSGGPLV-SNGYLVGLVNWGWPCATGVPDVHASVYFYRDW 254
            .....|.||||:|...::|.||||||:|||:| |.|.|||:.|||.||..|.|||.|.:.||..|
  Fly   200 YGGTPDLDVGHLCAVGKVGAGACHGDTGGPIVDSRGRLVGVGNWGVPCGYGFPDVFARISFYYSW 264

  Fly   255 IRNVMSG 261
            |.:.::|
  Fly   265 IISTING 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 93/220 (42%)
Tryp_SPc 38..258 CDD:238113 94/222 (42%)
CG31267NP_732214.1 Tryp_SPc 44..265 CDD:214473 93/220 (42%)
Tryp_SPc 45..268 CDD:238113 94/222 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D104368at6960
OrthoFinder 1 1.000 - - FOG0007620
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.