DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and CG31205

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_001287432.1 Gene:CG31205 / 318626 FlyBaseID:FBgn0051205 Length:274 Species:Drosophila melanogaster


Alignment Length:286 Identity:76/286 - (26%)
Similarity:128/286 - (44%) Gaps:56/286 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LSGLVSITAIR--IKGNSTD---GRF----YKDQRIIGGQAAEDGFAPYQISLQGIS--GAHS-- 63
            |:.|::||.:.  |:..|..   |.|    |....||    ||....|:.:.:.|::  |:::  
  Fly     7 LTFLLTITTLHPTIQAASVGQECGIFNEKQYNSDNII----AEPTEHPWVVRIVGVTKDGSNTLL 67

  Fly    64 CGGAIINETFVLTAAHCV---ENAFIPWLVVVTGTNKYNQPGGRYFLKAIHIHCNYDNPEMHNDI 125
            |.|.:|:...|:||||||   |:..| :.||...::..|    ...:.|:.:|.:|...:..||:
  Fly    68 CTGILIDSRRVVTAAHCVSKDESESI-YGVVFGDSDSSN----INLVSAVTVHPDYSPRKFENDL 127

  Fly   126 ALLELVEPIAWDERTQPIPLPLV-PMQPGDE-----VILTGWGSTVLWG---------TSPID-- 173
            |::||.:.:.:.:..|||.||.| .|.||.|     :|:.|     |.|         |..:|  
  Fly   128 AIIELTKEVVFSDLVQPICLPSVSEMVPGSETSNSKLIVAG-----LEGPSFDRRHSATQRLDKR 187

  Fly   174 LQVLYLQYVPHRECKALLSN-DEDCDVGHICTFSRLGEGACHGDSGGPLVSNGYLVGLVNWGWPC 237
            :::.|.: :..:||....:. .|:...|| ...|.|...|....||.|  ...:|:|:...|:..
  Fly   188 IKMTYTK-IDSKECHEKQARFPEELICGH-TERSPLSGSALTEASGTP--RQFHLLGIAVAGFFS 248

  Fly   238 ATGVPDVHASVYFYRDWIRNVMSGNS 263
            :......:.::..:.|||    |.||
  Fly   249 SDLDHQGYLNIRPHLDWI----SKNS 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 62/242 (26%)
Tryp_SPc 38..258 CDD:238113 64/244 (26%)
CG31205NP_001287432.1 Tryp_SPc 44..>168 CDD:304450 39/128 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.