DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and CG32808

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_726740.1 Gene:CG32808 / 318221 FlyBaseID:FBgn0052808 Length:284 Species:Drosophila melanogaster


Alignment Length:270 Identity:87/270 - (32%)
Similarity:125/270 - (46%) Gaps:39/270 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 ILLGLSGLVSITAIRIKGNSTDGRFYKDQRIIGGQAAEDGFAPYQISL-QGISGAHSCGGAIINE 71
            :|.|.||                   :|.:|:.|..|..|..|:.:|| :..||.||||..::|.
  Fly    19 LLAGASG-------------------EDGKIVNGTTAGPGEFPFVVSLRRAKSGRHSCGATLLNP 64

  Fly    72 TFVLTAAHCVENAFIPWLVVVTGTNKYNQPGGRYF-LKAIHIHCNYDNPEMH-NDIALLELVEPI 134
            .:||||||||..:....|.:..|:....:...:.. :.||.:|..|:..:.: ||||||:|.:.:
  Fly    65 YWVLTAAHCVRGSSPEQLDLQYGSQMLARNSSQVARVAAIFVHPGYEPEDKYVNDIALLQLAQSV 129

  Fly   135 AWDERTQPIPLPLVPMQ--PGD-EVILTGWGSTVLWGTSPIDLQVLYLQYVPHREC----KALLS 192
            |..:..||:.|| .|.|  ||: ..:|.|||.....|.....||.:.||.....||    :..|.
  Fly   130 ALSKFVQPVRLP-EPRQVTPGNASAVLAGWGLNATGGVVQQHLQKVKLQVFSDTECSERHQTYLH 193

  Fly   193 NDEDCDVGHICTFSRLGEGACHGDSGGP--LVSNGYLVGLVNWG-WPCA-TGVPDVHASVYFYRD 253
            :.:.|     ......|:|.|.||||||  |:.:...||:|:|. .||| ...|.|...|..|.|
  Fly   194 DSQIC-----AGLPEGGKGQCSGDSGGPLLLIGSDTQVGIVSWSIKPCARPPFPGVFTEVSAYVD 253

  Fly   254 WIRNVMSGNS 263
            ||...::..|
  Fly   254 WIVETVNSYS 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 79/231 (34%)
Tryp_SPc 38..258 CDD:238113 81/233 (35%)
CG32808NP_726740.1 Tryp_SPc 29..255 CDD:214473 79/231 (34%)
Tryp_SPc 30..258 CDD:238113 81/233 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449487
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.