DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and CG32755

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_727055.1 Gene:CG32755 / 318192 FlyBaseID:FBgn0052755 Length:315 Species:Drosophila melanogaster


Alignment Length:284 Identity:90/284 - (31%)
Similarity:133/284 - (46%) Gaps:52/284 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LLILLGLSGLVSITAIRI-KGNSTDGRFYKDQRIIGGQAAEDGFAPYQISLQ---------GISG 60
            |||:...||   ||..:| :..:|...|....:|:||........|:|:|::         |:  
  Fly     8 LLIVATHSG---ITQSQIGQPTATASPFVILPKIVGGYTVTIDQVPFQVSVRRRSIHERHYGL-- 67

  Fly    61 AHSCGGAIINETFVLTAAHCVE-NAFIPWL-------VVVTG------TNKYNQPGGRYFLKAIH 111
            .|.||||:|::..|.:||||.. |..:|.:       |||.|      |:::.|   .|.::.|.
  Fly    68 GHVCGGAVISQRVVCSAAHCYAINTSVPLVYRDPELYVVVAGSSAIDRTDRFTQ---EYLVQRIV 129

  Fly   112 IHCNYDNPEMHNDIALLELVEPIAWDE-RTQPIPLPLVPMQPGDEVILTGWGSTVLWGTSPIDLQ 175
            .|.:|:...:.||||||.|...|.|:. ..:.|||.:...:.|...::.|||...:...|     
  Fly   130 GHKDYNGSTLENDIALLFLNGFIPWESPGVRAIPLAIKAPEEGTTCLIHGWGKVTMKEKS----- 189

  Fly   176 VLYLQYVPHRECKALLSNDEDCDV------GHICT-FSRLGEGACHGDSGGPLVSNGYLVGLVNW 233
             ..||..|     ..:.|.|.|.|      ..:|. |.:.|..||.|||||||:.:|.|.|:::|
  Fly   190 -ASLQQAP-----VPILNKELCQVIYKLPASQMCAGFLQGGIDACQGDSGGPLICDGRLAGIISW 248

  Fly   234 GWPCA-TGVPDVHASVYFYRDWIR 256
            |..|| .|.|.|:.:|..:..|||
  Fly   249 GVGCADPGYPGVYTNVSHFLKWIR 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 77/249 (31%)
Tryp_SPc 38..258 CDD:238113 80/251 (32%)
CG32755NP_727055.1 Tryp_SPc 37..271 CDD:214473 77/249 (31%)
Tryp_SPc 38..273 CDD:238113 80/251 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.