DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and CG6041

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_572281.1 Gene:CG6041 / 31527 FlyBaseID:FBgn0029826 Length:308 Species:Drosophila melanogaster


Alignment Length:280 Identity:81/280 - (28%)
Similarity:124/280 - (44%) Gaps:46/280 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 VLLILLGLSGLVSITAIRIKGNSTDGRFYKDQRIIGGQAAEDGFAPYQISL-------QGISGAH 62
            :|.|.|.|..|.|..::   .:.|.|:.  :.:|:||..|......||:|:       :.....|
  Fly     7 ILAIALFLGALASGESL---SSETAGKI--EPKIVGGYDASIEQVSYQVSIRLTANDKKSYGSGH 66

  Fly    63 SCGGAIINETFVLTAAHCVENAFIPWLVVVTGTNKYNQPGG------------------RYFLKA 109
            .|||.:|::..|.|||||         ..:|...||...|.                  .|:|:.
  Fly    67 LCGGVVISQRLVATAAHC---------CYITDKKKYRTAGEFVLVMGSTYLTSSTDRTLMYYLQQ 122

  Fly   110 IHIHCNYDNPEMHNDIALLELVEPIAWDERT-QPIPLPLVPMQPGDEVILTGWGSTVLWGT-SPI 172
            :..|.||:...:.|||||:.:...|.|:..| ..:.|....:....:.:::|||.....|| |..
  Fly   123 LITHENYNPDALTNDIALMFINGYIPWNWPTVTALALNSQLVATNTDCLISGWGLLQQNGTFSSN 187

  Fly   173 DLQVLYLQYVPHRECKALLSNDEDCDVGHICT-FSRLGEGACHGDSGGPLVSNGYLVGLVNWGWP 236
            .||...:..|.:..|:...::   ..|..:|. :...|..||.||||||:..||.|.|:|::|..
  Fly   188 TLQAATVPIVSYTTCRISYNS---IPVSQVCAGYLSGGVDACQGDSGGPMSCNGMLAGIVSYGAG 249

  Fly   237 CAT-GVPDVHASVYFYRDWI 255
            ||. |.|.|:.:|.:|.|||
  Fly   250 CAAPGYPGVYTNVSYYYDWI 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 71/246 (29%)
Tryp_SPc 38..258 CDD:238113 73/247 (30%)
CG6041NP_572281.1 Tryp_SPc 34..269 CDD:214473 71/246 (29%)
Tryp_SPc 35..272 CDD:238113 73/247 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.