DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and Prtn3

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:XP_038934901.1 Gene:Prtn3 / 314615 RGDID:1304898 Length:422 Species:Rattus norvegicus


Alignment Length:257 Identity:81/257 - (31%)
Similarity:121/257 - (47%) Gaps:33/257 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 ITAIRIKGNSTDGRFY---KDQRIIGGQAAEDGFAPYQISLQGIS---GAHSCGGAIINETFVLT 76
            :..:|:.|    .||:   :..:|:||..|.....||..||| :|   |:|.|||.:|:..||||
  Rat   179 LPCLRLAG----VRFHGAVQASKIVGGHEARPHSRPYVASLQ-LSRSPGSHFCGGTLIHPRFVLT 238

  Fly    77 AAHCVENAFIPW--LVVVTGTNKY--NQPGGRYFLKAIHIHCNYDNPEMHNDIALLELVEPIAWD 137
            ||||:::  |.|  :.||.|.:..  ::|..:.|........||:..|..||:.||:|..|.:..
  Rat   239 AAHCLQD--ISWQLVTVVLGAHDLLSSEPEQQKFTITQVFENNYNPEETLNDVLLLQLNRPASLG 301

  Fly   138 ERTQPIPLPL--VPMQPGDEVILTGWGSTVLWGTSPIDLQVLYLQYVPHRECKALLSNDEDCDVG 200
            ::.....||.  ..:..|.:.:..|||.......:|..|..|.:..|...           |...
  Rat   302 KQVAVASLPQQDQSLSQGTQCLAMGWGRLGTRAPTPRVLHELNVTVVTFL-----------CREH 355

  Fly   201 HICTF-SRLGEGACHGDSGGPLVSNGYLVGLVNWG-WPCAT-GVPDVHASVYFYRDWIRNVM 259
            ::||. .|...|.|.|||||||:.||.|.|:.::. ..||: ..||..|.|..|.:||.:|:
  Rat   356 NVCTLVPRRAAGICFGDSGGPLICNGILHGVDSFVIRECASLQFPDFFARVSMYVNWIHSVL 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 74/229 (32%)
Tryp_SPc 38..258 CDD:238113 76/231 (33%)
Prtn3XP_038934901.1 Tryp_SPc 198..416 CDD:238113 76/231 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.