DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and LOC312273

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_001101326.1 Gene:LOC312273 / 312273 RGDID:1563848 Length:246 Species:Rattus norvegicus


Alignment Length:270 Identity:90/270 - (33%)
Similarity:133/270 - (49%) Gaps:32/270 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSAVVLLILLGLSGLVSITAIRIKGNSTDGRFYKDQRIIGGQAAEDGFAPYQISLQGISGAHSCG 65
            |...:...|||     ::.|...:.|        |.||:||...::...|||:||.  :|:|.||
  Rat     1 MKICIFFTLLG-----TVAAFPTEDN--------DDRIVGGYTCQEHSVPYQVSLN--AGSHICG 50

  Fly    66 GAIINETFVLTAAHCVENAFIPWLVVVTGT-NKYNQPGGRYFLKA--IHIHCNYDNPEMHNDIAL 127
            |::|.:.:||:||||    :.|.|.|..|. |.|...|...|:.|  :.:|.:||...:.|||.|
  Rat    51 GSLITDQWVLSAAHC----YHPQLQVRLGEHNIYEIEGAEQFIDAAKMILHPDYDKWTVDNDIML 111

  Fly   128 LELVEPIAWDERTQPIPLPLVPMQPGDEVILTGWGSTVLWGTSPIDLQVL----YLQYVPHRECK 188
            ::|..|...:.:...||||......|.|.:::|||.......||..||.|    ....|.|:...
  Rat   112 IKLKSPATLNSKVSTIPLPQYCPTAGTECLVSGWGVLKFGFESPSVLQCLDAPVLSDSVCHKAYP 176

  Fly   189 ALLSNDEDCDVGHICTFSRLGEGACHGDSGGPLVSNGYLVGLVNWGWPCA-TGVPDVHASVYFYR 252
            ..::|:..| :|    |...|:.:|..|||||:|.||.:.|:|:||..|| .|.|.|:..|..|.
  Rat   177 RQITNNMFC-LG----FLEGGKDSCQYDSGGPVVCNGEVQGIVSWGDGCALEGKPGVYTKVCNYL 236

  Fly   253 DWIRNVMSGN 262
            :||...::.|
  Rat   237 NWIHQTIAEN 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 80/225 (36%)
Tryp_SPc 38..258 CDD:238113 81/227 (36%)
LOC312273NP_001101326.1 Tryp_SPc 25..242 CDD:238113 81/227 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.