DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and CG3795

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_001284790.1 Gene:CG3795 / 31128 FlyBaseID:FBgn0025378 Length:305 Species:Drosophila melanogaster


Alignment Length:307 Identity:85/307 - (27%)
Similarity:127/307 - (41%) Gaps:85/307 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SAVVLLILLGLSGLVSITAIRIKGNSTDGRFYK--DQR----------IIGGQAAE-DGFAPYQI 53
            |..|:.||     |:|::| .....|..|:.:.  .||          :.||...: :....|.:
  Fly     4 SKFVVYIL-----LISVSA-NSNSESQAGQLHSAPSQRQDRPSDFQFLVTGGYRPDTNDLVKYTV 62

  Fly    54 SL------QGISGAHSCGGAIINETFVLTAAHCV----ENAFIPWLVVVTGTNKYNQPGGRYFLK 108
            ||      :.....|.|.|.|.:|..:||||||:    .......|:||.||       .|..||
  Fly    63 SLRMGKPKKFFGDNHFCAGTIFSERAILTAAHCMFSNRRKLKAKKLMVVAGT-------PRRLLK 120

  Fly   109 A----------IHIHCNYDNPEMHN-DIALLELVEPIAWDERTQPIPL-PLVPMQPGDEVILTGW 161
            :          :..|..|...:... ||.|:.|...::..:....||| ..||: .|....:.||
  Fly   121 SSTTQIIEAEELLPHPKYKKGKSQKYDIGLILLEADLSLGDAVAKIPLYNKVPV-AGAPCSIVGW 184

  Fly   162 GSTVLWGTSPI-----DLQVLYLQYVPHRECKALL---------SNDE-DCDVGHICTFSRLGEG 211
            |:.:.:|..|.     |:|:|     |...|:.||         :||: |.||           .
  Fly   185 GTVIQFGPLPDEAINGDMQIL-----PDTFCEKLLGWSNAGMLCANDKHDSDV-----------D 233

  Fly   212 ACHGDSGGPLVSNGYLVGLVNWGWPCATGVPD---VHASVYFYRDWI 255
            :|.|||||||:.:..:.|:|::|..|  |.||   ::..||.:||||
  Fly   234 SCQGDSGGPLICDNMVTGIVSFGMGC--GEPDSAGIYTDVYHFRDWI 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 73/268 (27%)
Tryp_SPc 38..258 CDD:238113 74/259 (29%)
CG3795NP_001284790.1 Tryp_SPc 60..281 CDD:238113 72/245 (29%)
Tryp_SPc 60..278 CDD:214473 70/243 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.