DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and CG14780

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_569920.2 Gene:CG14780 / 31102 FlyBaseID:FBgn0025383 Length:302 Species:Drosophila melanogaster


Alignment Length:301 Identity:90/301 - (29%)
Similarity:124/301 - (41%) Gaps:91/301 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 GLSG--------LVSITAIRIKGNSTDGRFYKDQRIIGGQAAEDGFAPYQISLQ------GISGA 61
            ||.|        |::..|..::.|       :..|||.|..|:.....:.:|::      .....
  Fly     5 GLHGCSYILFWFLLACAAADLQEN-------QQSRIINGSVAKADETRHLVSIRLLRHDNNFGSG 62

  Fly    62 HSCGGAIINETFVLTAAHCVEN----------AFIPWLVVVTGT-NKYNQPGGRYFLKA---IHI 112
            |.||||:|....|||||||:.|          .|    |||.|| |::....|....:.   .::
  Fly    63 HICGGALIAPRKVLTAAHCLYNNQRKRFRRASEF----VVVLGTLNRFEHRNGTIVSQVSSMAYM 123

  Fly   113 HCNYDNPEMHNDIALLELVEPIAWDERTQPIPLPLVPMQPGDEVILT------------------ 159
            | .:....|.:|:.:|.|        ||.      :||.||..|.||                  
  Fly   124 H-TFSPDSMRDDVGILFL--------RTG------LPMSPGGGVHLTVAPIQLAGQITPPGKLCQ 173

  Fly   160 --GWGSTVLWGTSPIDLQVLYLQYVPHRECK-----ALLSNDEDCDVGHICTFSRL--GEGACHG 215
              |||.|.....|.| |....:..:.|:.|:     .||.       |.:|. .||  |..:|.|
  Fly   174 VAGWGRTEQSSLSNI-LLTANVSTIRHQTCRMIYRSGLLP-------GMMCA-GRLQGGTDSCQG 229

  Fly   216 DSGGPLVSNGYLVGLVNWGWPCA-TGVPDVHASVYFYRDWI 255
            |||||||..|.|||:|:||:.|| .|:|.|:..|.:||.||
  Fly   230 DSGGPLVHEGRLVGVVSWGYGCAEPGLPGVYVDVEYYRQWI 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 82/265 (31%)
Tryp_SPc 38..258 CDD:238113 83/266 (31%)
CG14780NP_569920.2 Tryp_SPc 32..270 CDD:214473 82/265 (31%)
Tryp_SPc 33..271 CDD:238113 83/266 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.