DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and CG11664

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_569865.1 Gene:CG11664 / 31033 FlyBaseID:FBgn0040341 Length:254 Species:Drosophila melanogaster


Alignment Length:205 Identity:55/205 - (26%)
Similarity:88/205 - (42%) Gaps:31/205 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 GAIINETFVLTAAHCVENAFIPWLVVVTGTNKYNQPGGRYF--------LKAIHIHCNYDNPEMH 122
            |::.:..:|||.|||.:....|..:.|       :.|.|:.        :..:..|..:....:.
  Fly    49 GSLFSARYVLTVAHCFKKNTKPEELSV-------RAGYRWIAWEFRGKQVAGLLRHPKFSPLTLR 106

  Fly   123 NDIALLELVEPIAWDERTQPIPL---PLVPMQ---PGDEVILTGWGSTVLWGTSPIDLQVLYLQY 181
            ||||:|.:...|:.......|.|   ||.|:.   |..|  |.||  .::....|  |:.:.:|.
  Fly   107 NDIAVLRVKAAISHSHMINYIGLCSRPLTPLNMFAPPQE--LAGW--NLMHIAQP--LKSMSVQV 165

  Fly   182 VPHRECKALLSNDEDCDVGHICTFSRLGEGACHGDSGGPLVSNGYLVGLVNWGWPCA-TGVPDVH 245
            .|.:.|:...   .....|.||..:.:|||.|:||||.||:|.|.:.||......|. ...|.:.
  Fly   166 EPEKNCRQWF---PQISGGVICASATMGEGLCYGDSGDPLISGGEVCGLAIAFRKCGDKRYPALF 227

  Fly   246 ASVYFYRDWI 255
            ..|:::|.:|
  Fly   228 TDVHYHRAFI 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 54/203 (27%)
Tryp_SPc 38..258 CDD:238113 55/205 (27%)
CG11664NP_569865.1 Tryp_SPc 38..239 CDD:304450 55/205 (27%)
Tryp_SPc 38..237 CDD:214473 54/203 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.