DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and Ovch2

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:XP_003749007.2 Gene:Ovch2 / 308919 RGDID:1564636 Length:579 Species:Rattus norvegicus


Alignment Length:302 Identity:92/302 - (30%)
Similarity:143/302 - (47%) Gaps:48/302 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LLILLGLSGL-----VSITAIRIK--GNS-----TDGRFYKDQRIIGGQAAEDGFAPYQISLQGI 58
            |:::||:..|     .::::||..  |.|     ....|....||:||...|.|..|:|:||:. 
  Rat     8 LILILGIVCLEQGHSATLSSIRAPDCGKSLVKPWPQNYFSLFSRIVGGSQVEKGSYPWQVSLKQ- 71

  Fly    59 SGAHSCGGAIINETFVLTAAHCVENAFIPWLVVVT-GTNKYNQ--PGGRYF-LKAIHIHCNYDNP 119
            ...|.|||.||:..:|:|||||:.|..|...:.|| |.:..:|  ||.:.. ::.|.||..:...
  Rat    72 KQKHICGGTIISSQWVITAAHCMANRNIALTLNVTAGEHDLSQAEPGEQTLAIETIIIHPQFSTK 136

  Fly   120 E-MHNDIALLELVEPIAWDERTQPIPLPLVPMQPGDE----VILT--GWGSTVLWGTSPIDLQVL 177
            : |:.|||||::|....:.:..:|:.||    :||::    .|.|  |||.....|:.|..||.:
  Rat   137 KPMNYDIALLKMVGTFQFGQFVRPVCLP----EPGEQFNAGYICTTAGWGRLSEGGSLPQVLQQV 197

  Fly   178 YLQYVPHRECKALLSNDEDCDVG--HICTFS-RLGEGACHGDSGGPLVSNG-----YLVGLVNWG 234
            .|..:.|.||:|::....:...|  .:||.| ..|..||.|||||.|:...     .|.|:.:||
  Rat   198 NLPILTHEECEAVMLTLRNPITGKTFLCTGSPDGGRDACQGDSGGSLMCQNRKGAWTLAGVTSWG 262

  Fly   235 WPCA-----------TGVPDVHASVYFYRDWI-RNVMSGNSK 264
            ..|.           .|.|.:...:.....|| .:|.:|:.:
  Rat   263 LGCGRSWRNNARKKEQGSPGIFTDLRRVLPWIHEHVQTGHRR 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 79/247 (32%)
Tryp_SPc 38..258 CDD:238113 80/250 (32%)
Ovch2XP_003749007.2 Tryp_SPc 52..297 CDD:238113 80/249 (32%)
CUB 317..420 CDD:238001
CUB 431..541 CDD:238001
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.