DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and Klk8

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_001100979.1 Gene:Klk8 / 308565 RGDID:1305998 Length:260 Species:Rattus norvegicus


Alignment Length:282 Identity:81/282 - (28%)
Similarity:127/282 - (45%) Gaps:64/282 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 VVLLILLGL-SGLVSITAIRIKGNSTDGRFYKDQRIIGGQAAEDGFAPYQISL-QGISGAHSCGG 66
            ::|.:|:|. :||.     |.:|:          :|:.||..:....|:|.:| ||  ....|||
  Rat    13 ILLFLLMGAWAGLT-----RAQGS----------KILEGQECKPHSQPWQTALFQG--ERLVCGG 60

  Fly    67 AIINETFVLTAAHCVENAFIPWLVVVTGTNKYNQPGGRYFL-------------KAIHIHC-NYD 117
            .::.:.:|||||||.:             :||:...|.:.|             ::|...| |..
  Rat    61 VLVGDRWVLTAAHCKK-------------DKYSVRLGDHSLQKRDEPEQEIQVARSIQHPCFNSS 112

  Fly   118 NPEMH-NDIALLELVEPIAWDERTQPIPLPLVPMQPGDEVILTGWGSTVLWGTSPID-----LQV 176
            |||.| :||.|:.|.......::.:||.|..:..:.|.:.|::|||:.    |||.:     |..
  Rat   113 NPEDHSHDIMLIRLQNSANLGDKVKPIELANLCPKVGQKCIISGWGTV----TSPQENFPNTLNC 173

  Fly   177 LYLQYVPHRECKALLSNDEDCDVGHICTFSRLGEGACHGDSGGPLVSNGYLVGLVNWGW-PCATG 240
            ..::.....:|:.....  ....|.:|..|..|...|.||||||||.||.|.|:.:||. ||  |
  Rat   174 AEVKIYSQNKCERAYPG--KITEGMVCAGSSNGADTCQGDSGGPLVCNGVLQGITSWGSDPC--G 234

  Fly   241 VPD---VHASVYFYRDWIRNVM 259
            .|:   |:..:..|.:||:..|
  Rat   235 KPEKPGVYTKICRYTNWIKKTM 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 71/242 (29%)
Tryp_SPc 38..258 CDD:238113 73/244 (30%)
Klk8NP_001100979.1 Tryp_SPc 32..252 CDD:214473 71/242 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166341314
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.