DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and Klk12

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:XP_008757573.1 Gene:Klk12 / 308564 RGDID:1308975 Length:247 Species:Rattus norvegicus


Alignment Length:283 Identity:86/283 - (30%)
Similarity:125/283 - (44%) Gaps:59/283 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSAVVLLILLGLSGLVSITAIRIKGNSTDGRFYKDQRIIGGQAAEDGFAPYQISLQGISGAH-SC 64
            ::.::||.::|||     .|.|             ::|..|........|:|:.|  ..|.: .|
  Rat     3 LNILLLLCVVGLS-----QADR-------------EKIYNGVECVKNSQPWQVGL--FHGKYLRC 47

  Fly    65 GGAIINETFVLTAAHCVENAFIPWLVVVTGTNKYNQPGGRYFLKAIHI----------------H 113
            ||.:::..:|||||||              :.||....|.:.|..:.:                |
  Rat    48 GGVLVDRKWVLTAAHC--------------SGKYMVRLGEHSLSKLDLTEQLRLTTFSITHPSYH 98

  Fly   114 CNYDNPEMHNDIALLELVEPIAWDERTQPIPLPLVPMQPGDEVILTGWGST-VLWGTSPIDLQVL 177
            ..|.|.|  :|:.||.|..||:.....:|:.||......|.:..::|||:| ..|...|..||.|
  Rat    99 GAYQNHE--HDLRLLRLNRPISLTYAVRPVALPSSCAPTGAKCHISGWGTTNKPWDPFPDRLQCL 161

  Fly   178 YLQYVPHRECKALLSNDEDCDVGHICTFSRLGEGACHGDSGGPLVSNGYLVGLVNWG--WPCA-T 239
            .|..|.:..|:|:.......::  :|.....|:.||.||||||||..|.|.|||:||  .||. .
  Rat   162 DLSIVSNETCRAVFPGRVTENM--LCAGGEAGKDACQGDSGGPLVCGGVLQGLVSWGSVGPCGQK 224

  Fly   240 GVPDVHASVYFYRDWIRNVMSGN 262
            |:|.|:..|..|.||||.|:..|
  Rat   225 GIPGVYTKVCKYTDWIRVVIRNN 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 74/238 (31%)
Tryp_SPc 38..258 CDD:238113 77/240 (32%)
Klk12XP_008757573.1 Tryp_SPc 21..240 CDD:214473 74/238 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166341293
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.