DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and Klk14

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:XP_038956840.1 Gene:Klk14 / 308562 RGDID:1308606 Length:310 Species:Rattus norvegicus


Alignment Length:276 Identity:82/276 - (29%)
Similarity:129/276 - (46%) Gaps:45/276 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LLILLGLSGLVSITAIRIKGNSTDGRFYKDQRIIGGQAAEDGFAPYQISLQGISGAH-SCGGAII 69
            :|:||.:...:::..::.:|         |.:|:||........|:|::||...|.. .|||.::
  Rat    61 MLLLLTILQALAVAIVQSQG---------DDKILGGYTCVQNSQPWQVALQAGPGRRFLCGGVLL 116

  Fly    70 NETFVLTAAHCVENAFIPWLVVVTGTNKYNQPGGRYFLKAIHI-----HCNYDNPEMH-NDIALL 128
            ::.:|:|||||..    |.|.|..|  |:|........:.:.:     |..| .|:.| ||:.||
  Rat   117 SDQWVITAAHCAR----PLLHVALG--KHNLRRWEATQQVLRVVRQVPHPQY-RPQAHDNDLMLL 174

  Fly   129 ELVEPIAWDERTQPIPLPLVPMQPGDEVILTGWGSTVLWGTSPI-----DLQVLYLQYVP----H 184
            :|...:......:.||:......||....::|||:|    .|||     .||.:.:..:|    |
  Rat   175 KLQRKVRLGRAVRTIPVARSCASPGTPCRVSGWGTT----ASPIVRYPTALQCVNVNIMPEQVCH 235

  Fly   185 RECKALLSNDEDCDVGHICT-FSRLGEGACHGDSGGPLVSNGYLVGLVNWGWP-CA-TGVPDVHA 246
            |.....:::      |.:|. ....|:.:|.||||||||..|.|.|||:||.. || .|.|.|:.
  Rat   236 RAYPGTITS------GMVCAGVPEGGKDSCQGDSGGPLVCQGQLQGLVSWGMERCAMPGYPGVYT 294

  Fly   247 SVYFYRDWIRNVMSGN 262
            ::..|..||:..|..|
  Rat   295 NLCNYHSWIQRTMQSN 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 73/236 (31%)
Tryp_SPc 38..258 CDD:238113 75/238 (32%)
Klk14XP_038956840.1 Tryp_SPc 84..306 CDD:238113 75/238 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166341297
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.