DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and cfb

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:XP_021324426.1 Gene:cfb / 30604 ZFINID:ZDB-GENE-980526-487 Length:761 Species:Danio rerio


Alignment Length:329 Identity:72/329 - (21%)
Similarity:115/329 - (34%) Gaps:101/329 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LSGLVSITAIRIKGNSTDGR-FYK----------------DQRII---GGQAAEDG--------- 47
            ::||||        ...|.| |:|                |..::   |.|...||         
Zfish   428 MNGLVS--------EKKDERHFFKLPDLDEVQNTFDLMLDDSTVVGLCGMQQNYDGSNKRSAYPW 484

  Fly    48 FAPYQISLQGISGAHSCGGAIINETFVLTAAHCVENAFIPWLVVVTGTNKYNQPGGRYFLKAIHI 112
            .|...|:...||   .|.|:::...::||||||.:....|..:.|     |.:......::.:.|
Zfish   485 LAQLSIAQSQIS---DCMGSLVTSRYILTAAHCFKEGDTPDKITV-----YLEKNTDVKVEKVFI 541

  Fly   113 HCNYDNPEMHN---------DIALLELVEPIAWDERTQPIPLPLV--------------PMQPGD 154
            |.||......:         |:|||:|..|:......:||.||..              ..:..:
Zfish   542 HPNYSLTAKQSIGIKEFYDFDVALLQLKTPVKMSVNLRPICLPCTKETNRALKLSDSQGTCEKHE 606

  Fly   155 EVILTGWGSTVLWGTSPIDLQV--------------LYLQYVPHRECKALLSNDEDCDVGHICTF 205
            :::|:.......: ||.:|::.              .||........||  ...|..|.....|.
Zfish   607 QILLSNELVDAAF-TSKMDMEKRSPRKIRRITVKLGKYLDACVEDAKKA--KGIEVADATEAVTK 668

  Fly   206 SRLGEG---------ACHGDSGGPLVSNGY----LVGLVNWGWP--CATGVPDVHASVYFYRDWI 255
            :.|..|         :|.|:|||....:.|    .:|:|:||..  |:....|. .||...||:.
Zfish   669 NFLCSGGNQPQRDDVSCKGESGGATHVDKYGRLIQIGVVSWGVKNLCSKAKLDA-VSVSDSRDYH 732

  Fly   256 RNVM 259
            .|::
Zfish   733 INLL 736

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 62/281 (22%)
Tryp_SPc 38..258 CDD:238113 62/283 (22%)
cfbXP_021324426.1 CCP 95..150 CDD:153056
CCP 157..210 CDD:153056
vWA_complement_factors 257..455 CDD:238747 8/34 (24%)
Tryp_SPc 478..710 CDD:238113 50/242 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.