DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and bfb

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_571316.1 Gene:bfb / 30489 ZFINID:ZDB-GENE-990415-34 Length:456 Species:Danio rerio


Alignment Length:165 Identity:38/165 - (23%)
Similarity:53/165 - (32%) Gaps:66/165 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 RYFLKAIHIH-CNYDNPEMHNDIALLELVEPIAWDERTQPI--------PLPLVPMQPG------ 153
            ||::..:..: ||.|.....:.:.:.:  ....|:..| ||        |.|.||  ||      
Zfish   109 RYYINEVTTYSCNPDYKFRGSKVRVCQ--SNGKWNGST-PICERDSDHCPDPGVP--PGSSRTGS 168

  Fly   154 -----DEVI------LTGWGSTV-------LW-GTSPIDLQVLYLQYVPHRECKALLSNDEDCDV 199
                 |||.      ||..||.|       .| ||.|              :|.|..:.|...:|
Zfish   169 TFNIDDEVTYHCDSPLTLIGSKVRKCQDGGQWSGTEP--------------QCYADFTYDTAAEV 219

  Fly   200 GH--------ICTFSRLGEGACHG-----DSGGPL 221
            ..        :.|..:..|...||     :.||.|
Zfish   220 AKAFGNSLKTMLTVQQESEDDHHGKKIYLNKGGKL 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 38/165 (23%)
Tryp_SPc 38..258 CDD:238113 38/165 (23%)
bfbNP_571316.1 Sushi 29..77 CDD:278512
CCP 92..148 CDD:153056 9/41 (22%)
CCP 154..207 CDD:153056 18/68 (26%)
vWFA 254..450 CDD:294047 1/1 (100%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.