DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and Tpsg1

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_783183.1 Gene:Tpsg1 / 302990 RGDID:631355 Length:311 Species:Rattus norvegicus


Alignment Length:265 Identity:84/265 - (31%)
Similarity:123/265 - (46%) Gaps:52/265 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 RIIGGQAAEDGFAPYQISLQGISGAHSCGGAIINETFVLTAAHCVENAFIPWLVVVTGTNKYNQP 101
            ||:||.||:.|..|:|.||: :...|.|||::::..:|||||||...:        ..::.|...
  Rat    29 RIVGGHAAQAGAWPWQASLR-LQKVHVCGGSLLSPEWVLTAAHCFSGS--------VNSSDYEVH 84

  Fly   102 GGR-------YF--LKAIHIHCNYDNPE-MHNDIALLELVEPIAWDERTQPIPLP--LVPMQPGD 154
            .|.       :|  :|.|.::.:...|. ...||||::|..|:|...:.||:.||  .....||.
  Rat    85 LGELTITLSPHFSTVKQIIMYSSAPGPPGSSGDIALVQLATPVALSSQVQPVCLPEASADFHPGM 149

  Fly   155 EVILTGWGSTVLWG--TSPIDLQVLYLQYVPHRECK--------ALLSNDEDCDVGHICTFSRLG 209
            :..:||||.|....  ..|.:||...:..|....|.        :|:.:|      .:|.:   |
  Rat   150 QCWVTGWGYTQEGEPLKPPYNLQEAKVSVVDVETCSQAYSSSNGSLIQSD------MLCAW---G 205

  Fly   210 EG-ACHGDSGGPLVSN----GYLVGLVNWGWPCATGVPD---VHASVYFYRDWI-RNVMS-GNSK 264
            .| ||..|||||||..    ....|:|:||..|  |.||   |:|.|..|.:|| |:::. |.|.
  Rat   206 PGDACQDDSGGPLVCRVAGIWQQAGVVSWGEGC--GRPDRPGVYARVTAYVNWIHRHILEPGGSG 268

  Fly   265 CTGFS 269
            ..|.|
  Rat   269 MQGLS 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 77/247 (31%)
Tryp_SPc 38..258 CDD:238113 79/250 (32%)
Tpsg1NP_783183.1 Tryp_SPc 29..257 CDD:214473 77/247 (31%)
Tryp_SPc 30..260 CDD:238113 78/249 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.