DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and Prss42

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_001100333.2 Gene:Prss42 / 301027 RGDID:1562548 Length:340 Species:Rattus norvegicus


Alignment Length:241 Identity:76/241 - (31%)
Similarity:124/241 - (51%) Gaps:20/241 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 RIIGGQAAEDGFAPYQISLQGISGAHSCGGAIINETFVLTAAHCVENAFIPWLVVVTGTNKYNQP 101
            :|:||..||:|..|:|:||: :...|.|||:::|..:|||||||:.:. :.:.|.:...:.|.|.
  Rat    83 KIMGGVDAEEGKWPWQVSLR-VRHMHVCGGSLLNSQWVLTAAHCIHSR-VQYNVKMGDRSVYRQN 145

  Fly   102 GGRYF-LKAIHIHCNYDNPE-MHNDIALLELVEPIAWDERTQPIPLP--LVPMQPGDEVILTGWG 162
            ..... ::.|.:|..:.... :.||||||:|.:|:.:.....||.:|  ...::.|.:..:||||
  Rat   146 TSLVIPIQNIFVHPKFSTTTVVQNDIALLKLQQPVNFTSSIHPICVPTGTFHVKAGTKCWVTGWG 210

  Fly   163 STVLWGTSPIDLQVLY---LQYVPHRECKALLSNDEDCDV-----GHICTFSRLGEGACHGDSGG 219
            .... |...|..::|.   ...:.:.||..:|.......|     |.:|.:...|:.||.|||||
  Rat   211 KPDP-GAPQIPTEILQEVDQSIILYEECNEMLKKMASTSVDLVKRGMVCAYKEGGKDACQGDSGG 274

  Fly   220 PL---VSNGYL-VGLVNWGWPCA-TGVPDVHASVYFYRDWIRNVMS 260
            ||   ..|.:: :|:|:||..|. .|.|.|:..|.||..|:..|::
  Rat   275 PLSCEFDNRWVQIGVVSWGIGCGRKGHPGVYTDVAFYNKWLITVVN 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 74/234 (32%)
Tryp_SPc 38..258 CDD:238113 75/236 (32%)
Prss42NP_001100333.2 Tryp_SPc 83..314 CDD:214473 74/233 (32%)
Tryp_SPc 84..315 CDD:238113 74/233 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.