DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and Tmprss13

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_001121000.1 Gene:Tmprss13 / 300682 RGDID:1310872 Length:539 Species:Rattus norvegicus


Alignment Length:237 Identity:76/237 - (32%)
Similarity:107/237 - (45%) Gaps:17/237 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 RIIGGQAAEDGFAPYQISLQGISGAHSCGGAIINETFVLTAAHCV----ENAFIPWLVVVTGTNK 97
            ||:||....:...|:|:||. ....|.|||.:|:..:|||||||.    |.....| .|..||:.
  Rat   297 RIVGGALTSESKWPWQVSLH-FGTTHICGGTLIDAQWVLTAAHCFFVTREKILEGW-KVYAGTSN 359

  Fly    98 YNQPGGRYFLKAIHIHCNYDNPEMHNDIALLELVEPIAWDERTQPIPLPLVPMQPG--DEVILTG 160
            .:|......:..|.|:.||.:.:...||||:.|.:|:.......|..|||.....|  :...:||
  Rat   360 LHQLPEAASISQIIINGNYTDEQDDYDIALVRLSKPLTLSAHIHPACLPLHGQTFGLNETCWITG 424

  Fly   161 WGSTVLWG--TSPIDLQVLYLQYVPHRECKALLSNDEDCDVGHICTFS-RLGEGACHGDSGGPLV 222
            :|.|....  |||. |:.:.:..:..::|...|..|.......:|... |.|..:|.||||||||
  Rat   425 FGKTKETDEKTSPF-LREVQVNLIDFKKCNDYLVYDSYLTPRMMCAGDLRGGRDSCQGDSGGPLV 488

  Fly   223 ----SNGYLVGLVNWGWPCA-TGVPDVHASVYFYRDWIRNVM 259
                :..||.|:.:||..|. ...|.|:..|.....||...|
  Rat   489 CEQNNRWYLAGVTSWGTGCGQKNKPGVYTKVTEVLPWIYRKM 530

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 73/231 (32%)
Tryp_SPc 38..258 CDD:238113 74/233 (32%)
Tmprss13NP_001121000.1 WWbp <1..69 CDD:304964
SRCR_2 203..292 CDD:292133
SRCR 216..288 CDD:278931
Tryp_SPc 297..526 CDD:214473 73/231 (32%)
Tryp_SPc 298..526 CDD:238113 72/230 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.