DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and Elane

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_001100237.1 Gene:Elane / 299606 RGDID:1307968 Length:271 Species:Rattus norvegicus


Alignment Length:271 Identity:75/271 - (27%)
Similarity:117/271 - (43%) Gaps:47/271 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSAVVLLILLGLSGLVSITAIRIKGNSTDGRFYKDQRIIGGQAAEDGFAPYQISLQGISGAHSCG 65
            :::::|.:||....|.|                   .|:||:.|:....|:.:|||. .|.|.||
  Rat    15 LASMLLALLLVCPALAS-------------------EIVGGRPAQPHAWPFMVSLQR-RGGHFCG 59

  Fly    66 GAIINETFVLTAAHCVENAFIPWLVVVTGTN--KYNQPGGRYFLKAIHIHCNYDNPEMHNDIALL 128
            ..:|...||::|||||.......:.||.|.:  :..:|..:.|.........:|...:.|||.::
  Rat    60 ATLIARNFVMSAAHCVNGRNFQSVQVVLGAHDLRRREPTRQIFSVQRIFENGFDPSRLLNDIVII 124

  Fly   129 ELVEPIAWDERTQPIPLPLVPMQPGDEV--ILTGWGSTVLWGTS---PIDLQVLYLQYVPHRECK 188
            :|......:...|...||......|:..  :..|||..   ||:   |..||.|.:..|.:. |:
  Rat   125 QLNGSATINANVQVAELPAQGQGVGNRTPCVAMGWGRL---GTNRPLPSVLQELNVTVVTNL-CR 185

  Fly   189 ALLSNDEDCDVGHICTF-SRLGEGACHGDSGGPLVSNGYLVGL---VNWGWPCATG-VPDVHASV 248
            ..:         ::||. .|...|.|.||||||||.|..:.|:   :..|  |.:| .||..|.|
  Rat   186 RRV---------NVCTLVPRRQAGICFGDSGGPLVCNNLVQGIDSFIRGG--CGSGFYPDAFAPV 239

  Fly   249 YFYRDWIRNVM 259
            ..:.|||.:::
  Rat   240 AEFADWINSII 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 68/229 (30%)
Tryp_SPc 38..258 CDD:238113 70/231 (30%)
ElaneNP_001100237.1 Tryp_SPc 32..246 CDD:214473 68/229 (30%)
Tryp_SPc 33..249 CDD:238113 70/231 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.