DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and Cela3b

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_001100162.1 Gene:Cela3b / 298567 RGDID:1307819 Length:269 Species:Rattus norvegicus


Alignment Length:284 Identity:71/284 - (25%)
Similarity:113/284 - (39%) Gaps:55/284 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LVSITAIRIKGNSTDGRFYKDQRIIGGQAAEDGFAPYQISLQ----GISGAHSCGGAIINETFVL 75
            |.|:..:.:........:....|::.|:.|.....|:|:|||    | |..|:|||.:|...:|:
  Rat     5 LCSLLLVALASGCGQPSYNPSSRVVNGEDAVPYSWPWQVSLQYEKDG-SFHHTCGGTLIAPDWVM 68

  Fly    76 TAAHCVENAFIPWLVVVTGTNKYNQPGGRYFLKA------IHIHCNYDNPEMHNDIALLELVEPI 134
            ||.||:..: ..:.||:....:..:.|....:..      :|...|.:.....|||||::|....
  Rat    69 TAGHCISTS-RTYQVVLGEFERGVEEGPEQVIPVNAGDLFVHPKWNSNCVSCGNDIALVKLSRSA 132

  Fly   135 AWDERTQPIPLPLVPMQPGDEVI-------LTGWGSTVLWGTSPIDLQVLYLQYVPHREC----- 187
            ...:..|...||     |..|::       ::|||.....|..|..||...|..|.:..|     
  Rat   133 QLGDTVQLACLP-----PAGEILPNGAPCYISGWGRLSTNGPLPDKLQQALLPVVDYAHCSKWDW 192

  Fly   188 ------KALLSNDEDCDVGHICTFSRLGEGACHGDSGGPL---VSNG--YLVGLVNW--GWPCAT 239
                  |.::     |..|.|       :..|:|||||||   ..||  .:.|:.::  ...|.|
  Rat   193 WGFSVKKTMV-----CAGGDI-------QSGCNGDSGGPLNCPAENGTWQVHGVTSFVSSLGCNT 245

  Fly   240 -GVPDVHASVYFYRDWIRNVMSGN 262
             ..|.|...|..:.:||...::.|
  Rat   246 LKKPTVFTRVSAFNEWIEETIANN 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 66/253 (26%)
Tryp_SPc 38..258 CDD:238113 67/255 (26%)
Cela3bNP_001100162.1 Tryp_SPc 27..262 CDD:214473 66/253 (26%)
Tryp_SPc 28..265 CDD:238113 67/255 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.