DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and Klk1c9

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_786935.1 Gene:Klk1c9 / 292868 RGDID:727805 Length:259 Species:Rattus norvegicus


Alignment Length:252 Identity:70/252 - (27%)
Similarity:113/252 - (44%) Gaps:43/252 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 RIIGGQAAEDGFAPYQISLQGISGAHSCGGAIINETFVLTAAHCVENAFIPWLVVVTGTNKY--N 99
            |::||...|....|:|::   :.|...|||.:|:.::|:|||||....:    .|:.|.|..  :
  Rat    24 RVVGGYNCETNSQPWQVA---VIGTTFCGGVLIDPSWVITAAHCYSKNY----RVLLGRNNLVKD 81

  Fly   100 QPGGRYFLKAIHIHCNYDNPEM----------------HNDIALLELVEPIAWDERTQPIPLPLV 148
            :|    |.:...:..::.:|:.                :||:.||.|.:|.......:.|.||..
  Rat    82 EP----FAQRRLVSQSFQHPDYIPVFMRNHTRQRAYDHNNDLMLLHLSKPADITGGVKVIDLPTE 142

  Fly   149 PMQPGDEVILTGWGSTVLWGTSPI------DLQVLYLQYVPHRECKALLSNDEDCDVGHICTFSR 207
            ..:.|...:.:|||.     |:|.      |||.:.:..:.:.:|.....|.| .||........
  Rat   143 EPKVGSICLASGWGM-----TNPSEMKLSHDLQCVNIHLLSNEKCIETYKNIE-TDVTLCAGEMD 201

  Fly   208 LGEGACHGDSGGPLVSNGYLVGLVNWG-WPCA-TGVPDVHASVYFYRDWIRNVMSGN 262
            .|:..|.|||||||:.:|.|.||.:.| .||| ...|.::|.:..:..||:.||..|
  Rat   202 GGKDTCTGDSGGPLICDGVLQGLTSGGATPCAKPKTPAIYAKLIKFTSWIKKVMKEN 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 65/243 (27%)
Tryp_SPc 38..258 CDD:238113 66/245 (27%)
Klk1c9NP_786935.1 Tryp_SPc 24..251 CDD:214473 65/243 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166341303
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.