DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and Klk1c8

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_001013085.2 Gene:Klk1c8 / 292866 RGDID:1305359 Length:261 Species:Rattus norvegicus


Alignment Length:246 Identity:78/246 - (31%)
Similarity:112/246 - (45%) Gaps:29/246 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 RIIGGQAAEDGFAPYQISLQGISGAHSCGGAIINETFVLTAAHCVENAFIPWLVVVTGTN----- 96
            |||||...|....|:|:::...: ...|||.:|:.::|:|||||....:..||    |.|     
  Rat    24 RIIGGFNCEKNSQPWQVAVYHFN-EPQCGGVLIHPSWVITAAHCYSVNYQVWL----GRNNLLED 83

  Fly    97 -----------KYNQPGGRYFLKAIHIHCNYDNPEMHNDIALLELVEPIAWDERTQPIPLPLVPM 150
                       .:..||  :.|..|..|......:..||:.||.|..|....:..:.|.||....
  Rat    84 EPFAQHRLVSQSFPHPG--FNLDIIKNHTRKPGNDYSNDLMLLHLKTPADITDGVKVIDLPTEEP 146

  Fly   151 QPGDEVILTGWGS-TVLWGTSPIDLQVLYLQYVPHREC-KALLSNDEDCDVGHICTFSRLGEGAC 213
            :.|...:.:|||| |.|....|.|||.:.:..:.:.:| ||.  |||..||.........|:..|
  Rat   147 KVGSTCLTSGWGSITPLKWEFPDDLQCVNIHLLSNEKCIKAY--NDEVTDVMLCAGEMDGGKDIC 209

  Fly   214 HGDSGGPLVSNGYLVGLVNWG-WPCA-TGVPDVHASVYFYRDWIRNVMSGN 262
            .|||||||:.:|.|.|:.:|| .||. ...|.|:..:..:..||:.||..|
  Rat   210 KGDSGGPLICDGVLQGITSWGSMPCGEPNKPSVYTKLIKFTSWIKKVMKEN 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 73/237 (31%)
Tryp_SPc 38..258 CDD:238113 74/239 (31%)
Klk1c8NP_001013085.2 Tryp_SPc 24..253 CDD:214473 73/237 (31%)
Tryp_SPc 25..256 CDD:238113 74/239 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166341295
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.