DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and Klk1c10

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_001128645.1 Gene:Klk1c10 / 292858 RGDID:1561403 Length:259 Species:Rattus norvegicus


Alignment Length:286 Identity:84/286 - (29%)
Similarity:126/286 - (44%) Gaps:58/286 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 VVLLILLGLSGLVSITAIRIKGNSTDGRFYKDQRIIGGQAAEDGFAPYQISLQGISGAHSCGGAI 68
            ::|.:.|.|.|:             |.......||:||...|....|:|::   |...:.|||.:
  Rat     4 LILFLALSLGGI-------------DAAPPGQSRIVGGYKCEKNSQPWQVA---IINEYLCGGVL 52

  Fly    69 INETFVLTAAHCVENAFIPWLVVVTGTNKY--NQPGGRY-FLKAIHIHCNYD-----------NP 119
            |:.::|:|||||..|    :..|:.|.|..  ::|..:| |:.....|.:|.           ..
  Rat    53 IDPSWVITAAHCYSN----YYHVLLGRNNLFEDEPFAQYRFVNQSFPHPDYKPFLMRNHTRQRGD 113

  Fly   120 EMHNDIALLELVEPIAWDERTQPIPLPLVPMQPGDEVILTGWGST--VLWGTSPIDLQVLYLQYV 182
            :..||:.||.|.||....:..:.|.||....:.|...:.:|||||  :.| ..|.|||.:.:.  
  Rat   114 DYSNDLMLLHLSEPADITDGVKVIDLPTEEPKVGSTCLASGWGSTKPLNW-ELPDDLQCVNIH-- 175

  Fly   183 PHRECKALLSNDEDCDVGH--------ICTFSRLG-EGACHGDSGGPLVSNGYLVGLVNWG-WPC 237
                   |||| |.|...:        :|.....| :..|.|||||||:.:|.|.|:.:|| .||
  Rat   176 -------LLSN-EKCIEAYEQKVTDLMLCAGEMDGRKDTCKGDSGGPLICDGVLQGITSWGNVPC 232

  Fly   238 ATGV-PDVHASVYFYRDWIRNVMSGN 262
            |... |.|:..:..:..||:.||..|
  Rat   233 AEPYNPGVYTKLIKFTSWIKEVMKEN 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 74/244 (30%)
Tryp_SPc 38..258 CDD:238113 75/246 (30%)
Klk1c10NP_001128645.1 Tryp_SPc 24..251 CDD:214473 74/244 (30%)
Tryp_SPc 25..254 CDD:238113 75/246 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166341291
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.