DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and Klk1c12

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:XP_017444409.1 Gene:Klk1c12 / 292855 RGDID:1303192 Length:262 Species:Rattus norvegicus


Alignment Length:255 Identity:77/255 - (30%)
Similarity:122/255 - (47%) Gaps:44/255 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 RIIGGQAAEDGFAPYQISLQGISGAHSCGGAIINETFVLTAAHCVENAFIPWLVVVTGTNKY-NQ 100
            |::||...|....|:|::   :...:.|||.:|:.::|:|||||..:|...:.|::...|.: ::
  Rat    24 RVVGGYKCEKNSQPWQVA---VINRYLCGGVLIDPSWVITAAHCYSHALSNYHVLLGRNNLFKDE 85

  Fly   101 PGGRY-FLKAIHIHCNYDNP------------EMHNDIALLELVEPIAWDERTQPIPLPLVPMQP 152
            |..:| |:.....|.:| ||            :..||:.||.|.||....:..:.|.||....:.
  Rat    86 PFAQYRFVNQSFPHPDY-NPFFMKNHTLFPGDDHSNDLMLLHLSEPADITDGVKVIDLPTEEPKV 149

  Fly   153 GDEVILTGWGST--VLWGTSPIDLQVLYLQYVPHRECKALLSNDEDCDVGH--------ICTFSR 207
            |...:.:||.||  :.| ..|.|||.:.:.         :||| |.|...|        :|. ..
  Rat   150 GSTCLASGWSSTKPLEW-EFPDDLQCVNIN---------ILSN-EKCIKAHTQMVTDVMLCA-GE 202

  Fly   208 L--GEGACHGDSGGPLVSNGYLVGLVNW-GWPCA-TGVPDVHASVYFYRDWIRNVMSGNS 263
            |  |:..|:|||||||:.:|.|.|:.:| ..||. |..|.::..:..:..||:.||..||
  Rat   203 LEGGKDTCNGDSGGPLLCDGVLQGITSWSSVPCGETNRPAIYTKLIKFTSWIKEVMKENS 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 71/245 (29%)
Tryp_SPc 38..258 CDD:238113 72/247 (29%)
Klk1c12XP_017444409.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166341302
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.