DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and Klk7

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:XP_017444408.1 Gene:Klk7 / 292852 RGDID:1306420 Length:249 Species:Rattus norvegicus


Alignment Length:271 Identity:80/271 - (29%)
Similarity:123/271 - (45%) Gaps:49/271 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 VLLILLGLSGLVSITAIRIKGNSTDGRFYKDQRIIGGQAAEDGFAPYQISLQGISGAHSCGGAII 69
            :|.:||.|       |:...|        :.:|||.|...::|..|:|::|......| |||.::
  Rat     8 LLTVLLSL-------ALETAG--------QGERIIDGYKCKEGSHPWQVALLKGDQLH-CGGVLV 56

  Fly    70 NETFVLTAAHCVENAFIPWLVVVTGTNKY-NQPGGRYFLKAIHIHCNYDNPEMHNDIALLELVEP 133
            .|::|||||||....:    .|..|::|. :|...|........|..|......|||.|:::.:|
  Rat    57 GESWVLTAAHCKMGQY----TVHLGSDKIEDQSAQRIKASRSFRHPGYSTRTHVNDIMLVKMDKP 117

  Fly   134 IAWDERTQPIPLPLVPMQPGDEVILTGWGSTVLWG-TSPIDLQVLYLQYVPHRECKALLSNDEDC 197
            :...::.|.:.||.....||....::|||:|.... |.|.||....::.:..:|||.:..:    
  Rat   118 VKMSDKVQKVKLPDHCEPPGTLCTVSGWGTTTSPDVTFPSDLMCSDVKLISSQECKKVYKD---- 178

  Fly   198 DVGHICTFSRLGE------------GACHGDSGGPLVSNGYLVGLVNWG-WPCA-TGVPDVHASV 248
                     .||:            ..|:||||||||.|..|.|||:|| :||. ...|.|:..|
  Rat   179 ---------LLGKTMLCAGIPDSKTNTCNGDSGGPLVCNDTLQGLVSWGTYPCGQPNDPGVYTQV 234

  Fly   249 YFYRDWIRNVM 259
            ..|:.|:.:.|
  Rat   235 CKYQRWLEDTM 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 72/233 (31%)
Tryp_SPc 38..258 CDD:238113 72/235 (31%)
Klk7XP_017444408.1 Tryp_SPc 25..240 CDD:214473 72/232 (31%)
Tryp_SPc 26..244 CDD:238113 72/235 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166341299
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.