DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and Klk10

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_001004100.1 Gene:Klk10 / 292850 RGDID:1303242 Length:279 Species:Rattus norvegicus


Alignment Length:297 Identity:79/297 - (26%)
Similarity:130/297 - (43%) Gaps:73/297 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSAVVLLILLGLSGLVSITAIRIKGNSTDGRFYKDQRIIGGQAAEDGFAPYQISLQGISGAHS-- 63
            :|.|.||:.|.:..|.:..|:.:.||:|     ::.....|........|:|:||     .|:  
  Rat    15 LSLVKLLLPLLMMQLWAAQALLLPGNTT-----REDLEAFGTLCPSVSQPWQVSL-----FHNLQ 69

  Fly    64 --CGGAIINETFVLTAAHCVENAFIPWLV-----------VVTGTN------KYNQPGGRYFLKA 109
              |.|.::::.:|||||||..|..:...|           .:..||      || ||        
  Rat    70 FQCAGVLVDQNWVLTAAHCWRNKPLRARVGDDHLLLFQSEQLRSTNSPVFHPKY-QP-------- 125

  Fly   110 IHIHCNYDNPEM-----HNDIALLELVEPIAWDERTQPIPLPLVPMQPGDEVILTGWGSTVLWGT 169
                |:  .|.:     .:|:.:|:|..|:....:..|:.||....||..|..::|||:|.    
  Rat   126 ----CS--GPVLPLRSDEHDLMMLKLSSPVVLTSKVHPVQLPFQCAQPRQECQVSGWGTTA---- 180

  Fly   170 SPIDLQVLYLQYVPHREC-KALLSNDEDCDVGH--------ICTFSRLGEGACHGDSGGPLVSNG 225
               :.:|.|.:.:   .| :..|.:.:.|:..:        ||......:.:|..|||||||.:.
  Rat   181 ---NRRVKYNRSL---SCSRVTLLSQKQCETFYPGVITNNMICAGMDRDQDSCQSDSGGPLVCDN 239

  Fly   226 YLVGLVNWG-WPC--ATGVPDVHASVYFYRDWIRNVM 259
            .|.|:::|. :||  ||..|.|:|.:..|.:|||.|:
  Rat   240 TLHGILSWSIYPCGAATQYPAVYAKICNYTNWIRRVI 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 65/255 (25%)
Tryp_SPc 38..258 CDD:238113 68/257 (26%)
Klk10NP_001004100.1 Tryp_SPc 50..272 CDD:214473 65/251 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.