DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and Klk11

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_001099722.1 Gene:Klk11 / 292849 RGDID:1308690 Length:279 Species:Rattus norvegicus


Alignment Length:287 Identity:82/287 - (28%)
Similarity:128/287 - (44%) Gaps:59/287 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSAVVLLILLGLSGLVSITAIRIKGNSTDGRFYKDQRIIGGQAAEDGFAPYQISLQGISGAHSCG 65
            :.|:::|..:.|: ||:            |....:.|||.|........|:|::|...:.. .||
  Rat    27 LQAMMILRFIALA-LVT------------GHVGGETRIIKGYECRPHSQPWQVALFQKTRL-LCG 77

  Fly    66 GAIINETFVLTAAHCVENAFIPWLVVVTG----------------TNKYNQPGGRYFLKAIHIHC 114
            ..:|...::||||||.:    |..|::.|                |..:..||         .:.
  Rat    78 ATLIAPKWLLTAAHCRK----PHYVILLGEHNLEKTDGCEQRRMATESFPHPG---------FNN 129

  Fly   115 NYDNPEMHNDIALLELVEPIAWDERTQPIPLPLVPMQPGDEVILTGWGSTVLWGTS-----PIDL 174
            :..|.:..|||.|:::..|.......:|:.|..:.:..|...:::|||:|    :|     |..|
  Rat   130 SLPNKDHRNDIMLVKMSSPAFITRAVRPLTLSSLCVTAGTSCLISGWGTT----SSPQLRLPHSL 190

  Fly   175 QVLYLQYVPHREC-KALLSNDEDCDVGHICTFSRL-GEGACHGDSGGPLVSNGYLVGLVNWGW-P 236
            :...:..:.|:|| :|...|..|.   .:|...|. |:.:|.||||||||.||.|.|:::||. |
  Rat   191 RCANVSIIGHKECERAYPGNITDT---MLCASVRKEGKDSCQGDSGGPLVCNGSLQGIISWGQDP 252

  Fly   237 CA-TGVPDVHASVYFYRDWIRNVMSGN 262
            || |..|.|:..|..|.|||..||..|
  Rat   253 CAVTRKPGVYTKVCKYFDWIHEVMRNN 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 71/242 (29%)
Tryp_SPc 38..258 CDD:238113 72/244 (30%)
Klk11NP_001099722.1 Tryp_SPc 50..272 CDD:214473 71/242 (29%)
Tryp_SPc 51..275 CDD:238113 72/244 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166341313
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.