DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and Klk13

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_001163876.1 Gene:Klk13 / 292848 RGDID:1309337 Length:276 Species:Rattus norvegicus


Alignment Length:293 Identity:81/293 - (27%)
Similarity:128/293 - (43%) Gaps:71/293 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 AVVLLILLGLSGLVSITAIRIKGNSTDGRFYKDQRIIGGQAAEDGF-----------APYQISLQ 56
            |.:..:.|.|||.:|             |.|  .:|:.|.....||           .|:|.:|.
  Rat     6 ATIACLTLALSGGIS-------------RDY--PKILNGTNGTSGFLPGGYTCLPHSQPWQAALL 55

  Fly    57 GISGAHSCGGAIINETFVLTAAHCVENAFIPWLVVVTGTNKYNQ-PGGRYFLKAIH--------- 111
             :.|...|||.:::..:|||||||.::.:    .|..|.:...: ..|...::.:.         
  Rat    56 -VRGRLLCGGVLVHPKWVLTAAHCRKDGY----TVHLGKHALGRVENGEQAMEVVRSIPHPEYQV 115

  Fly   112 --IHCNYDNPEMHNDIALLELVEPIAWDERTQPIPLPLVPMQP-GDEVILTGWGSTVLWGTSPID 173
              .|.|:|     :||.||||..|:......:.:.|......| |....::|||:|    |||  
  Rat   116 SPTHLNHD-----HDIMLLELKSPVQLSNHVRTLQLSADDCLPTGTCCRVSGWGTT----TSP-- 169

  Fly   174 LQVLYLQYVPHRECKAL-LSNDEDC--------DVGHICTFSRL-GEGACHGDSGGPLVSNGYLV 228
             ||.|.:.:   :|..: |.:||:|        ....:|..::. |:.:|.|||||||:.||.|.
  Rat   170 -QVNYPKTL---QCANIELRSDEECRQVYPGKITANMLCAGTKEGGKDSCEGDSGGPLICNGKLY 230

  Fly   229 GLVNWG-WPCA-TGVPDVHASVYFYRDWIRNVM 259
            |:::|| :||. ...|.|:..|..|..||:..:
  Rat   231 GIISWGDFPCGQPNRPGVYTRVSKYLRWIQGTI 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 71/253 (28%)
Tryp_SPc 38..258 CDD:238113 73/255 (29%)
Klk13NP_001163876.1 Tryp_SPc 39..262 CDD:238113 69/242 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.