DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and Gzmm

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_476531.1 Gene:Gzmm / 29252 RGDID:620022 Length:264 Species:Rattus norvegicus


Alignment Length:269 Identity:85/269 - (31%)
Similarity:128/269 - (47%) Gaps:35/269 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LLILLGLSGLVSITAIRIKGNSTDGRFYKDQRIIGGQAAEDGFAPYQISLQGISGAHSCGGAIIN 70
            ||:||.|..|.::      ||    ||  :.:||||:.|.....||.:|||. :.:|.|||.:::
  Rat     7 LLLLLALKTLWAV------GN----RF--EAQIIGGREAVPHSRPYMVSLQN-TKSHVCGGVLVH 58

  Fly    71 ETFVLTAAHCVENAFIPWLVVVTGTNKYN---QPGGRYFLKAIHIHCNYDNPEMHNDIALLELVE 132
            :.:|||||||:... :..|.:|.|.:..:   .||..:::|....|..| |.:..||:|||:|..
  Rat    59 QKWVLTAAHCLSEP-LQQLKLVFGLHSLHDPQDPGLTFYIKQAIKHPGY-NLKYENDLALLKLDG 121

  Fly   133 PIAWDERTQPIPLPLVPMQ---PGDEVILTGWGSTVLWGTSPIDLQVLYLQYVPHREC------K 188
            .:...:..:|:.||..|..   .|......|||.|...|.....||.|.|:.:..|.|      .
  Rat   122 RVKPSKNVKPLALPRKPRDKPAEGSRCSTAGWGITHQRGQLAKSLQELDLRLLDTRMCNNSRFWN 186

  Fly   189 ALLSNDEDCDVGHICTFSRLGEGACHGDSGGPLV-SNGYLVGLVNWGWPCATGV--PDVHASVYF 250
            .:|::...|     ......|:..|.|||||||| ..|.:.|::::.....|.:  |.|..:|..
  Rat   187 GVLTDSMLC-----LKAGAKGQAPCKGDSGGPLVCGKGKVDGILSFSSKNCTDIFKPTVATAVAP 246

  Fly   251 YRDWIRNVM 259
            |..|||.|:
  Rat   247 YSSWIRKVI 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 71/232 (31%)
Tryp_SPc 38..258 CDD:238113 74/234 (32%)
GzmmNP_476531.1 Tryp_SPc 27..254 CDD:238113 74/234 (32%)
Trypsin 27..251 CDD:278516 71/231 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.