DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and F2

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_075213.2 Gene:F2 / 29251 RGDID:61996 Length:617 Species:Rattus norvegicus


Alignment Length:267 Identity:85/267 - (31%)
Similarity:131/267 - (49%) Gaps:48/267 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 YKDQRIIGGQAAEDGFAPYQISLQGISGAH-SCGGAIINETFVLTAAHCVENAFIPW-------- 88
            |.|.||:.|..||.|.||:|:.|...|... .||.::|::.:|||||||:  .:.||        
  Rat   355 YIDGRIVEGWDAEKGIAPWQVMLFRKSPQELLCGASLISDRWVLTAAHCI--LYPPWDKNFTEND 417

  Fly    89 LVVVTGTNKYNQPGGRY--------FLKAIHIHCNYD-NPEMHNDIALLELVEPIAWDERTQPIP 144
            |:|..|  |:::.  ||        .|:.|:||..|: ...:..|||||:|.:|:.:.:...|:.
  Rat   418 LLVRIG--KHSRT--RYERNVEKISMLEKIYIHPRYNWRENLDRDIALLKLKKPVPFSDYIHPVC 478

  Fly   145 LP-----LVPMQPGDEVILTGWGS-TVLWGTS-----PIDLQVLYLQYVPHRECKA----LLSND 194
            ||     ...:|.|.:..:||||: ...|.|:     |..|||:.|..|....|||    .::::
  Rat   479 LPDKQTVTSLLQAGYKGRVTGWGNLRETWTTNINEIQPSVLQVVNLPIVERPVCKASTRIRITDN 543

  Fly   195 EDCDVGHICTFSRLGEGACHGDSGGPLVSNG------YLVGLVNWGWPC-ATGVPDVHASVYFYR 252
            ..| .|.....::.|: ||.||||||.|...      |.:|:|:||..| ..|....:..|:..:
  Rat   544 MFC-AGFKVNDTKRGD-ACEGDSGGPFVMKSPYNHRWYQMGIVSWGEGCDRNGKYGFYTHVFRLK 606

  Fly   253 DWIRNVM 259
            .|::.|:
  Rat   607 RWMQKVI 613

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 81/257 (32%)
Tryp_SPc 38..258 CDD:238113 81/259 (31%)
F2NP_075213.2 GLA 25..89 CDD:214503
KR 107..189 CDD:214527
Kringle 215..292 CDD:278480
Thrombin_light 312..359 CDD:286482 2/3 (67%)
Tryp_SPc 359..608 CDD:214473 81/256 (32%)
Tryp_SPc 360..612 CDD:238113 81/259 (31%)
High affinity receptor-binding region which is also known as the TP508 peptide 547..569 10/22 (45%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.