DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and F10

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_058839.1 Gene:F10 / 29243 RGDID:61850 Length:482 Species:Rattus norvegicus


Alignment Length:266 Identity:81/266 - (30%)
Similarity:119/266 - (44%) Gaps:32/266 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 SGLVSITAIRIKGNSTDGRFYKDQRIIGGQAAEDGFAPYQISL---QGISGAHSCGGAIINETFV 74
            |.|:::.....:.||.|     ..||:|||..:.|..|:|..|   :...|  .|||.|:||.::
  Rat   212 SELLNLNKTEPEANSDD-----VIRIVGGQECKRGECPWQALLFSDEETDG--FCGGTILNEFYI 269

  Fly    75 LTAAHCVENAFIPWLVVVTGTNKYNQPGGR--YFLKAIHIHCNYDNPEMHNDIALLELVEPIAWD 137
            ||||||:..| ..:.|.|...|...:.||.  :.:..|..|..:.......|||:|.|..||.:.
  Rat   270 LTAAHCLHQA-KRFKVRVGDLNTEQEDGGEMVHEVDMIIKHNKFQRDTYDFDIAMLRLKTPITFR 333

  Fly   138 ERTQPIPLP--------LVPMQPGDEVILTGWGSTVLWGTSPIDLQVLYLQYVPHRECKALLSND 194
            |...|..||        |:..:.|   |::|:|.|...|.....|:::.:.||....|:  ||..
  Rat   334 ENVAPACLPQKDWAEATLMTQKTG---IVSGFGRTHEKGRQSKVLKMMEVPYVDRNTCR--LSTS 393

  Fly   195 EDCDVGHICT-FSRLGEGACHGDSGGPLVS----NGYLVGLVNWGWPCA-TGVPDVHASVYFYRD 253
            ........|. :....|.||.||||||.|:    ..::.|:|:||..|| .|...::..|..:..
  Rat   394 FSITQNMFCAGYDAKQEDACQGDSGGPHVTRFKDTYFVTGIVSWGEGCARKGKYGIYTKVTAFLK 458

  Fly   254 WIRNVM 259
            ||...|
  Rat   459 WIDRSM 464

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 73/236 (31%)
Tryp_SPc 38..258 CDD:238113 74/238 (31%)
F10NP_058839.1 GLA 23..84 CDD:214503
EGF_CA 86..122 CDD:238011
FXa_inhibition 129..164 CDD:405372
Tryp_SPc 232..462 CDD:238113 74/237 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.