DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and F11

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:XP_006253206.1 Gene:F11 / 290757 RGDID:1309364 Length:622 Species:Rattus norvegicus


Alignment Length:274 Identity:86/274 - (31%)
Similarity:121/274 - (44%) Gaps:52/274 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 GLSGL---------VSITAIRIKGNSTDGRFYKDQRIIGGQAAEDGFAPYQISLQGISGAHSCGG 66
            |:||.         |..|.||             .|:.||.|:..|..|:|::|....| |.|||
  Rat   365 GISGYTLRLCKMDNVCTTKIR-------------PRVFGGAASVHGEWPWQVTLHTTQG-HLCGG 415

  Fly    67 AIINETFVLTAAHCVENAFIPWLVVVTG----TNKYNQPGGRYFLKAIHIHCNYDNPEMHNDIAL 127
            :||...::||||||......|..:.|.|    .::.|:....:.::.:.||..|.:.|...||||
  Rat   416 SIIGNRWILTAAHCFSGTETPKTLRVYGGIVNQSEINEDTTFFRVQEMIIHDQYTSAESGFDIAL 480

  Fly   128 LELVEPIAWDERTQPIPLPLVPMQPGD------EVILTGWGSTVLWGTSPIDLQVLYLQYVPHRE 186
            |:|...:.:.:..:||.||    ..||      |..:||||.|.........||...:..|.:.|
  Rat   481 LKLEPAMNYTDFQRPICLP----SKGDRNVVHTECWVTGWGYTKSRDEVQSTLQKAKVPLVSNEE 541

  Fly   187 C-----KALLSNDEDCDVGHICTFSRLGEGACHGDSGGPL--VSNG--YLVGLVNWGWPCATGV- 241
            |     |..::|...|     ..:...|:..|.|||||||  ..||  :|||:.:||..|.... 
  Rat   542 CQTRYRKHKITNKVIC-----AGYKEGGKDTCKGDSGGPLSCKHNGVWHLVGITSWGEGCGQKER 601

  Fly   242 PDVHASVYFYRDWI 255
            |.|:.:|..|.|||
  Rat   602 PGVYTNVAKYVDWI 615

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 77/237 (32%)
Tryp_SPc 38..258 CDD:238113 78/238 (33%)
F11XP_006253206.1 APPLE 20..103 CDD:128519
APPLE 110..193 CDD:128519
APPLE 200..283 CDD:128519
APPLE 291..374 CDD:128519 3/8 (38%)
Tryp_SPc 387..615 CDD:214473 77/237 (32%)
Tryp_SPc 388..615 CDD:238113 76/236 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.