DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and TMPRSS11E

DIOPT Version :10

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_054777.2 Gene:TMPRSS11E / 28983 HGNCID:24465 Length:423 Species:Homo sapiens


Alignment Length:230 Identity:79/230 - (34%)
Similarity:114/230 - (49%) Gaps:14/230 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 RIIGGQAAEDGFAPYQISLQGISGAHSCGGAIINETFVLTAAHCVENAFIP--WLVVVTGTNKYN 99
            ||:||...|:|..|:|.|||. .|:|.||..:||.|::::||||......|  |......|.|.:
Human   191 RIVGGTEVEEGEWPWQASLQW-DGSHRCGATLINATWLVSAAHCFTTYKNPARWTASFGVTIKPS 254

  Fly   100 QPGGRYFLKAIHIHCNYDNPEMHNDIALLELVEPIAWDERTQPIPLP--LVPMQPGDEVILTGWG 162
            :.  :..|:.|.:|..|.:|....||:|.||..|:.:......:.||  ....||||.:.:||:|
Human   255 KM--KRGLRRIIVHEKYKHPSHDYDISLAELSSPVPYTNAVHRVCLPDASYEFQPGDVMFVTGFG 317

  Fly   163 STVLWGTSPIDLQVLYLQYVPHRECKALLSNDEDCDVGHICTFSRLGE-GACHGDSGGPLVSNG- 225
            :....|.|...|:...:..:....|....:.::......:|..|..|: .||.|||||||||:. 
Human   318 ALKNDGYSQNHLRQAQVTLIDATTCNEPQAYNDAITPRMLCAGSLEGKTDACQGDSGGPLVSSDA 382

  Fly   226 ----YLVGLVNWGWPCA-TGVPDVHASVYFYRDWI 255
                ||.|:|:||..|| ...|.|:..|...||||
Human   383 RDIWYLAGIVSWGDECAKPNKPGVYTRVTALRDWI 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 38..258 CDD:238113 78/229 (34%)
TMPRSS11ENP_054777.2 SEA 51..147 CDD:460188
Tryp_SPc 192..420 CDD:238113 78/229 (34%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.