DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and Prss38

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:XP_006246600.1 Gene:Prss38 / 287358 RGDID:1565729 Length:380 Species:Rattus norvegicus


Alignment Length:244 Identity:74/244 - (30%)
Similarity:119/244 - (48%) Gaps:37/244 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 RIIGGQAAEDGFAPYQISLQGISGAHSCGGAIINETFVLTAAHCVEN----AFIPWLVVVTG--- 94
            :::||:...|...|:|:|:. .:|.|.|||:|:|..:|||||||...    ......|.:|.   
  Rat   113 KLLGGELTIDRKWPWQVSIH-YAGFHVCGGSILNAYWVLTAAHCFAREKRLQTFDMYVGITNLEV 176

  Fly    95 TNKYNQPGGRYF-LKAIHIHCNYD--NPEMHNDIALLELVEPIAWDERTQPIPLPLVPMQPGD-E 155
            .||:.|    :| :..:.||..::  :| :..|:||::....|.:.:...||.||...:...| .
  Rat   177 ANKHTQ----WFEINQVIIHPTFEMFHP-VGGDVALVQSKSAIVFSDYVLPICLPSSNLNLSDLS 236

  Fly   156 VILTGWGSTVLWGTSPIDLQVLYLQYVPHRECKAL------LSNDEDC--DVGHICTFSRLGEGA 212
            ...||||.....|.:..||....|..:|..:|:.|      |..:..|  |:.::       :..
  Rat   237 CWTTGWGMVSPQGETGKDLLEAQLPLIPKFQCQLLYGLTSYLLPEMLCAGDIKNM-------KNV 294

  Fly   213 CHGDSGGPL---VSNGYL-VGLVNWGWPCATGV-PDVHASVYFYRDWIR 256
            |.||||.||   |:..:| :|:|:||..||..: |.|.|:|.::.:|||
  Rat   295 CEGDSGSPLVCKVNQTWLQIGIVSWGRGCAQPLYPGVFANVSYFLNWIR 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 71/241 (29%)
Tryp_SPc 38..258 CDD:238113 74/243 (30%)
Prss38XP_006246600.1 Tryp_SPc 116..343 CDD:238113 72/239 (30%)
Tryp_SPc 116..342 CDD:214473 71/238 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.