DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and Prss29

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:XP_017453326.1 Gene:Prss29 / 287136 RGDID:1305856 Length:279 Species:Rattus norvegicus


Alignment Length:258 Identity:84/258 - (32%)
Similarity:125/258 - (48%) Gaps:49/258 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 IIGGQAAEDGFAPYQISLQ-----GISGAHSCGGAIINETFVLTAAHCVE------NAFIPWLVV 91
            |:||.:|..|..|:|:||:     ..|..|.|||:||:..:|||||||:.      :||..:|  
  Rat    31 IVGGNSAPQGKWPWQVSLRVYRYNWASWVHICGGSIIHPQWVLTAAHCIHESDADPSAFRIYL-- 93

  Fly    92 VTGTNKYNQPGGRYFLKA--IHIHCNYDNPEMHNDIALLELVEPIAWDERTQPIPLPLVPMQ--P 152
                .:....||...||.  :.||.::....:.:|:|||:|.:.:......:|:.|....::  .
  Rat    94 ----GQVYLYGGEKLLKVSRVIIHPDFVRSGLGSDVALLQLAQSVRSFPNVKPVKLSPASLEVTK 154

  Fly   153 GDEVILTGWGSTVLWGT--SPIDLQVLYLQYVPHRECKAL------LSN--------DEDCDVGH 201
            .|...:|||||..:..:  .|..||.:.::.|.:..|:.|      |||        |..|...|
  Rat   155 KDVCWVTGWGSVSMHESLPPPYRLQQVQVKIVDNTLCEKLYRNATRLSNHGQRLILQDMLCAGSH 219

  Fly   202 ICTFSRLGEGACHGDSGGPLVSN----GYLVGLVNWGWPCA-TGVPDVHASVYFYRDWIRNVM 259
                   |..:|:||||||||.|    ..|||:|:||:.|| ..:|.|:|.|.|:..||...|
  Rat   220 -------GRDSCYGDSGGPLVCNVTGSWTLVGVVSWGYGCALKDIPGVYARVQFFLPWITGQM 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 81/252 (32%)
Tryp_SPc 38..258 CDD:238113 83/255 (33%)
Prss29XP_017453326.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.