DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and Prss27

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_891994.3 Gene:Prss27 / 287108 RGDID:1303256 Length:328 Species:Rattus norvegicus


Alignment Length:280 Identity:93/280 - (33%)
Similarity:140/280 - (50%) Gaps:27/280 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSAVVLLILLGLSGLVSITAIRIKGNSTDGRFYKDQRIIGGQAAEDGFAPYQISLQGISGAHSCG 65
            ::|::||.||..||.....|:|..|:.   |.:  .|::||:.|.:|..|:|:|:|. :|||.||
  Rat     6 ITALLLLPLLLRSGTEGAEAMRACGHP---RMF--NRMVGGEDALEGEWPWQVSIQR-NGAHFCG 64

  Fly    66 GAIINETFVLTAAHCVEN-AFIPWLVVVTGTNKYNQPGGRYF---LKAIHIHCNYDNPEMHNDIA 126
            |::|..|:|||||||..| :.|....|:.|..|..|||....   :|.:..|..|.......|:|
  Rat    65 GSLIAPTWVLTAAHCFSNTSDISIYQVLLGALKLQQPGPHALYVPVKRVKSHPEYQGMASSADVA 129

  Fly   127 LLELVEPIAWDERTQPI--PLPLVPMQPGDEVILTGWGSTVLWG--TSPIDLQVLYLQYVPHREC 187
            |:||..|:.:.:...|:  |.|.|..:.|....:|||||.....  .:|..||.|.:..:...:|
  Rat   130 LVELQVPVTFTKYILPVCLPDPSVVFKSGMNCWVTGWGSPSEQDRLPNPRILQKLAVPLIDTPKC 194

  Fly   188 KALLSNDEDCDV-------GHICT-FSRLGEGACHGDSGGPLV----SNGYLVGLVNWGWPCA-T 239
            ..|.|.|.:.|:       ..:|. |:...:.||.||||||||    .:....|:::||..|| .
  Rat   195 NLLYSKDAEADIQLKTIKDDMLCAGFAEGKKDACKGDSGGPLVCLVDQSWVQAGVISWGEGCARR 259

  Fly   240 GVPDVHASVYFYRDWIRNVM 259
            ..|.|:..|..:..||..::
  Rat   260 NRPGVYIRVASHYQWIHQII 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 80/238 (34%)
Tryp_SPc 38..258 CDD:238113 81/240 (34%)
Prss27NP_891994.3 Tryp_SPc 37..275 CDD:214473 80/238 (34%)
Tryp_SPc 39..278 CDD:238113 81/239 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.