DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31269 and LOC286960

DIOPT Version :9

Sequence 1:NP_001097818.1 Gene:CG31269 / 318653 FlyBaseID:FBgn0051269 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_775423.1 Gene:LOC286960 / 286960 RGDID:708585 Length:247 Species:Rattus norvegicus


Alignment Length:238 Identity:83/238 - (34%)
Similarity:123/238 - (51%) Gaps:21/238 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 DQRIIGGQAAEDGFAPYQISL-QGISGAHSCGGAIINETFVLTAAHCVENAFIPWLVVVTGT-NK 97
            |.:|:||........|||:|| .|||  |.|||::|::.:||:||||.:..    |.|..|. |.
  Rat    21 DDKIVGGYTCPKHLVPYQVSLHDGIS--HQCGGSLISDQWVLSAAHCYKRK----LQVRLGEHNI 79

  Fly    98 YNQPGGRYFLKAIHI--HCNYDNPEMHNDIALLELVEPIAWDERTQPIPLPLVPMQPGDEVILTG 160
            :...||..|:.|..|  |..|:...:.|||.|::|..|...:.:...:.||........:.:::|
  Rat    80 HVLEGGEQFIDAEKIIRHPEYNKDTLDNDIMLIKLKSPAVLNSQVSTVSLPRSCASTDAQCLVSG 144

  Fly   161 WGSTV-LWGTSPIDLQVLYLQYVPHRECK----ALLSNDEDCDVGHICTFSRLGEGACHGDSGGP 220
            ||:|| :.|..|..||.|....:....||    ..::::..| :|    |...|:.:|.||||||
  Rat   145 WGNTVSIGGKYPALLQCLEAPVLSASSCKKSYPGQITSNMFC-LG----FLEGGKDSCDGDSGGP 204

  Fly   221 LVSNGYLVGLVNWGWPCA-TGVPDVHASVYFYRDWIRNVMSGN 262
            :|.||.:.|:|:||..|| .|.|.|:..|..|..||:..|:.|
  Rat   205 VVCNGEIQGIVSWGSVCAMRGKPGVYTKVCNYLSWIQETMANN 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31269NP_001097818.1 Tryp_SPc 37..255 CDD:214473 78/227 (34%)
Tryp_SPc 38..258 CDD:238113 80/229 (35%)
LOC286960NP_775423.1 Tryp_SPc 23..240 CDD:214473 78/227 (34%)
Tryp_SPc 24..243 CDD:238113 80/229 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.